KEGG   Escherichia coli K-12 W3110: JW2637Help
Entry
JW2637            CDS       T00068                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase, PLP-dependent
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00250  Alanine, aspartate and glutamate metabolism
ecj00280  Valine, leucine and isoleucine degradation
ecj00410  beta-Alanine metabolism
ecj00640  Propanoate metabolism
ecj00650  Butanoate metabolism
ecj01100  Metabolic pathways
ecj01120  Microbial metabolism in diverse environments
Module
ecj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    JW2637 (gabT)
   00650 Butanoate metabolism
    JW2637 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    JW2637 (gabT)
   00280 Valine, leucine and isoleucine degradation
    JW2637 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    JW2637 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecj01007]
    JW2637 (gabT)
Enzymes [BR:ecj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     JW2637 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     JW2637 (gabT)
Amino acid related enzymes [BR:ecj01007]
 Aminotransferase (transaminase)
  Class III
   JW2637 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAA16525
UniProt: P22256
LinkDB All DBs
Structure
PDB: 

Position
2791391..2792671
Genome map
AA seq 426 aa AA seqDB search
MNSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FDEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggcgttggg
caaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctgcatccg
aaggtggtggccgcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcttacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccgggcgat
ttcgccaagaaaacgctgctggttacgaccggttccgaagcggtggaaaacgcggtaaaa
atcgcccgcgccgccaccaaacgtagcggcaccatcgcttttagcggcgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggg
ctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcataagcgag
gatgacgctatcgccagcatccaccggatcttcaaaaatgatgccgcgccggaagatatc
gccgccatcgtgattgagccggttcagggcgaaggcggtttctacgcctcgtcgccagcc
tttatgcagcgtttacgcgctctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcggggcgtaccggcacgctgtttgcgatggagcagatgggcgttgcg
ccggatcttaccacctttgcgaaatcgatcgcgggcggcttcccgctggcgggcgtcacc
gggcgcgcggaagtaatggatgccgtcgctccaggcggtctgggcggcacctatgcgggt
aacccgattgcctgcgtggctgcgctggaagtgttgaaggtgtttgagcaggaaaatctg
ctgcaaaaagccaacgatctggggcagaagttgaaagacggattgctggcgatagccgaa
aaacacccggagatcggcgacgtacgcgggctgggggcgatgatcgccattgagctgttt
gaagacggcgatcacaacaagccggacgccaaactcaccgccgagatcgtggctcgcgcc
cgcgataaaggcctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgatgaggcgaagcagtag

DBGET integrated database retrieval system