KEGG   Escherichia coli K-12 W3110: JW2869Help
Entry
JW2869            CDS       T00068                                 

Gene name
bglA
Definition
(GenBank) 6-phospho-beta-glucosidase A
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00010  Glycolysis / Gluconeogenesis
ecj00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JW2869 (bglA)
   00500 Starch and sucrose metabolism
    JW2869 (bglA)
Enzymes [BR:ecj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     JW2869 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: BAE76966
UniProt: Q46829
LinkDB All DBs
Structure
PDB: 

Position
3042318..3043757
Genome map
AA seq 479 aa AA seqDB search
MIVKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVLPGKY
YPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMFDE
LLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE
INNQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINPEMKVGC
MLAMVPLYPYSCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGD
LDVLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRY
ALCELYERYQRPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLM
GYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGEKL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgaaaaaactcaccttaccgaaagatttcttatggggcggcgcagttgccgct
catcaggtcgaaggcggctggaacaaaggcggaaaagggccgagcatttgtgacgttctg
accggtggcgcacacggcgtgccgcgcgaaatcaccaaagaagtcttgccaggaaaatac
tatccaaaccatgaagccgttgatttttatggtcactataaggaagacatcaagctattt
gccgaaatgggcttcaaatgttttcgtacatccattgcctggacgcgcatttttccaaaa
ggcgatgaagctcagccaaacgaagaagggctgaagttctacgatgatatgttcgatgaa
ctgctgaaatacaacatcgaaccggtgatcaccctctcccactttgaaatgccgctgcat
ctggtgcagcaatacggtagctggaccaaccgtaaagtggttgatttctttgtacgtttc
gcggaagtggtatttgaacgctataagcacaaagtcaaatactggatgaccttcaacgaa
attaacaaccagcgtaactggcgtgcaccgctgttcggttactgctgctccggcgtggtg
tataccgagcatgaaaacccggaagagacgatgtatcaggtgctgcatcaccagtttgtc
gccagcgccctggcggtgaaagctgcgcgtcgcattaacccggagatgaaagtcggctgt
atgctggcgatggtgccgctctatccttactcctgtaacccggacgatgtgatgttcgct
caggagtcgatgcgcgaacgctacgtctttaccgatgtgcagctacgcggctattacccg
tcctatgtgttgaacgagtgggagcgtcgcggatttaacatcaaaatggaagacggcgat
ctggatgtgctgcgtgaaggcacctgcgattatcttggtttcagctattacatgaccaat
gcagtgaaggccgaaggcggcaccggcgatgcgatctctggttttgaaggcagcgtacca
aacccgtatgttaaagcatctgactggggctggcagattgatccagtaggtctgcgctat
gcactttgcgaactgtatgagcgttatcagaggccgctgtttattgtcgaaaacggtttt
ggcgcttacgacaaagtggaagaagatggcagcatcaacgacgactaccgcattgactac
ctgcgcgcccatatcgaagagatgaaaaaagcggtgacttacgatggcgtggatctgatg
ggctacacaccgtggggctgcatcgactgcgtgtcgttcaccaccgggcagtacagcaaa
cgctacggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttca
cgtaagaagagctttaactggtacaaagaggtgattgccagcaacggcgagaagctttaa

DBGET integrated database retrieval system