KEGG   Escherichia coli K-12 W3110: JW3352Help
Entry
JW3352            CDS       T00068                                 

Gene name
aroB
Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ecj01100  Metabolic pathways
ecj01110  Biosynthesis of secondary metabolites
ecj01130  Biosynthesis of antibiotics
ecj01230  Biosynthesis of amino acids
Module
ecj_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    JW3352 (aroB)
Enzymes [BR:ecj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     JW3352 (aroB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: BAE77902
UniProt: P07639
LinkDB All DBs
Position
4121930..4123018
Genome map
AA seq 362 aa AA seqDB search
MERIVVTLGERSYPITIASGLFNEPASFLPLKSGEQVMLVTNETLAPLYLDKVRGVLEQA
GVNVDSVILPDGEQYKSLAVLDTVFTALLQKPHGRDTTLVALGGGVVGDLTGFAAASYQR
GVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDLDCLKTLPPRELAS
GLAEVIKYGIILDGAFFNWLEENLDALLRLDGPAMAYCIRRCCELKAEVVAADERETGLR
ALLNLGHTFGHAIEAEMGYGNWLHGEAVAAGMVMAARTSERLGQFSSAETQRIITLLKRA
GLPVNGPREMSAQAYLPHMLRDKKVLAGEMRLILPLAIGKSEVRSGVSHELVLNAIADCQ
SA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggagaggattgtcgttactctcggggaacgtagttacccaattaccatcgcatctggt
ttgtttaatgaaccagcttcattcttaccgctgaaatcgggcgagcaggtcatgttggtc
accaacgaaaccctggctcctctgtatctcgataaggtccgcggcgtacttgaacaggcg
ggtgttaacgtcgatagcgttatcctccctgacggcgagcagtataaaagcctggctgta
ctcgataccgtctttacggcgttgttacaaaaaccgcatggtcgcgatactacgctggtg
gcgcttggcggcggcgtagtgggcgatctgaccggcttcgcggcggcgagttatcagcgc
ggtgtccgtttcattcaagtcccgacgacgttactgtcgcaggtcgattcctccgttggc
ggcaaaactgcggtcaaccatcccctcggtaaaaacatgattggcgcgttctaccaacct
gcttcagtggtggtggatctcgactgtctgaaaacgcttcccccgcgtgagttagcgtcg
gggctggcagaagtcatcaaatacggcattattcttgacggtgcgttttttaactggctg
gaagagaatctggatgcgttgttgcgtctggacggtccggcaatggcgtactgtattcgc
cgttgttgtgaactgaaggcagaagttgtcgccgccgacgagcgcgaaaccgggttacgt
gctttactgaatctgggacacacctttggtcatgccattgaagctgaaatggggtatggc
aattggttacatggtgaagcggtcgctgcgggtatggtgatggcggcgcggacgtcggaa
cgtctcgggcagtttagttctgccgaaacgcagcgtattataaccctgctcaagcgggct
gggttaccggtcaatgggccgcgcgaaatgtccgcgcaggcgtatttaccgcatatgctg
cgtgacaagaaagtccttgcgggagagatgcgcttaattcttccgttggcaattggtaag
agtgaagttcgcagcggcgtttcgcacgagcttgttcttaacgccattgccgattgtcaa
tcagcgtaa

DBGET integrated database retrieval system