KEGG   Escherichia coli K-12 W3110: JW3396Help
Entry
JW3396            CDS       T00068                                 

Gene name
asd
Definition
(GenBank) aspartate-semialdehyde dehydrogenase, NAD(P)-binding
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00260  Glycine, serine and threonine metabolism
ecj00261  Monobactam biosynthesis
ecj00270  Cysteine and methionine metabolism
ecj00300  Lysine biosynthesis
ecj01100  Metabolic pathways
ecj01110  Biosynthesis of secondary metabolites
ecj01120  Microbial metabolism in diverse environments
ecj01130  Biosynthesis of antibiotics
ecj01210  2-Oxocarboxylic acid metabolism
ecj01230  Biosynthesis of amino acids
Module
ecj_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
ecj_M00017  Methionine biosynthesis, apartate => homoserine => methionine
ecj_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JW3396 (asd)
   00270 Cysteine and methionine metabolism
    JW3396 (asd)
   00300 Lysine biosynthesis
    JW3396 (asd)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    JW3396 (asd)
Enzymes [BR:ecj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     JW3396 (asd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: BAE77859
UniProt: P0A9Q9
LinkDB All DBs
Structure
PDB: 

Position
4065537..4066640
Genome map
AA seq 367 aa AA seqDB search
MKNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQDAFDL
EALKALDIIVTCQGGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVIT
DGLNNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGARHMRELLTQMG
HLYGHVADELATPSSAILDIERKVTTLTRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSR
EEWKGQAETNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNP
WAKVVPNDREITMRELTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLR
RMLRQLA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgttggttttatcggctggcgcggtatggtcggctccgttctcatgcaacgc
atggttgaagagcgcgacttcgacgccattcgccctgtcttcttttctacttctcagctt
ggccaggctgcgccgtcttttggcggaaccactggcacacttcaggatgcctttgatctg
gaggcgctaaaggccctcgatatcattgtgacctgtcagggcggcgattataccaacgaa
atctatccaaagcttcgtgaaagcggatggcaaggttactggattgacgcagcatcgtct
ctgcgcatgaaagatgacgccatcatcattcttgaccccgtcaatcaggacgtcattacc
gacggattaaataatggcatcaggacttttgttggcggtaactgtaccgtaagcctgatg
ttgatgtcgttgggtggtttattcgccaatgatcttgttgattgggtgtccgttgcaacc
taccaggccgcttccggcggtggtgcgcgacatatgcgtgagttattaacccagatgggc
catctgtatggccatgtggcagatgaactcgcgaccccgtcctctgctattctcgatatc
gaacgcaaagtcacaaccttaacccgtagcggtgagctgccggtggataactttggcgtg
ccgctggcgggtagcctgattccgtggatcgacaaacagctcgataacggtcagagccgc
gaagagtggaaagggcaggcggaaaccaacaagatcctcaacacatcttccgtaattccg
gtagatggtttatgtgtgcgtgtcggggcattgcgctgccacagccaggcattcactatt
aaattgaaaaaagatgtgtctattccgaccgtggaagaactgctggctgcgcacaatccg
tgggcgaaagtcgttccgaacgatcgggaaatcactatgcgtgagctaaccccagctgcc
gttaccggcacgctgaccacgccggtaggccgcctgcgtaagctgaatatgggaccagag
ttcctgtcagcctttaccgtgggcgaccagctgctgtggggggccgcggagccgctgcgt
cggatgcttcgtcaactggcgtaa

DBGET integrated database retrieval system