KEGG   Escherichia coli K-12 W3110: JW3914Help
Entry
JW3914            CDS       T00068                                 

Gene name
katG
Definition
(GenBank) catalase/hydroperoxidase HPI(I)
  KO
K03782  catalase-peroxidase [EC:1.11.1.21]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00360  Phenylalanine metabolism
ecj00380  Tryptophan metabolism
ecj01100  Metabolic pathways
ecj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    JW3914 (katG)
   00380 Tryptophan metabolism
    JW3914 (katG)
Enzymes [BR:ecj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.21  catalase-peroxidase
     JW3914 (katG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: peroxidase
Motif
Other DBs
NCBI-ProteinID: BAE77368
UniProt: P13029
LinkDB All DBs
Structure
PDB: 

Position
complement(3500666..3502846)
Genome map
AA seq 726 aa AA seqDB search
MSTSDDIHNTTATGKCPFHQGGHDQSAGAGTTTRDWWPNQLRVDLLNQHSNRSNPLGEDF
DYRKEFSKLDYYGLKKDLKALLTESQPWWPADWGSYAGLFIRMAWHGAGTYRSIDGRGGA
GRGQQRFAPLNSWPDNVSLDKARRLLWPIKQKYGQKISWADLFILAGNVALENSGFRTFG
FGAGREDVWEPDLDVNWGDEKAWLTHRHPEALAKAPLGATEMGLIYVNPEGPDHSGEPLS
AAAAIRATFGNMGMNDEETVALIAGGHTLGKTHGAGPTSNVGPDPEAAPIEEQGLGWAST
YGSGVGADAITSGLEVVWTQTPTQWSNYFFENLFKYEWVQTRSPAGAIQFEAVDAPEIIP
DPFDPSKKRKPTMLVTDLTLRFDPEFEKISRRFLNDPQAFNEAFARAWFKLTHRDMGPKS
RYIGPEVPKEDLIWQDPLPQPIYNPTEQDIIDLKFAIADSGLSVSELVSVAWASASTFRG
GDKRGGANGARLALMPQRDWDVNAAAVRALPVLEKIQKESGKASLADIIVLAGVVGVEKA
ASAAGLSIHVPFAPGRVDARQDQTDIEMFELLEPIADGFRNYRARLDVSTTESLLIDKAQ
QLTLTAPEMTALVGGMRVLGANFDGSKNGVFTDRVGVLSNDFFVNLLDMRYEWKATDESK
ELFEGRDRETGEVKFTASRADLVFGSNSVLRAVAEVYASSDAHEKFVKDFVAAWVKVMNL
DRFDLL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgtcagacgatatccataacaccacagccactggcaaatgcccgttccatcag
ggcggtcacgaccagagtgcgggggcgggcacaaccactcgcgactggtggccaaatcaa
cttcgtgttgacctgttaaaccaacattctaatcgttctaacccactgggtgaggacttt
gactaccgcaaagaattcagcaaattagattactacggcctgaaaaaagatctgaaagcc
ctgttgacagaatctcaaccgtggtggccagccgactggggcagttacgccggtctgttt
attcgtatggcctggcacggcgcggggacttaccgttcaatcgatggacgcggtggcgcg
ggtcgtggtcagcaacgttttgcaccgctgaactcctggccggataacgtaagcctcgat
aaagcgcgtcgcctgttgtggccaatcaaacagaaatatggtcagaaaatctcctgggcc
gacctgtttatcctcgcgggtaacgtggcgctagaaaactccggcttccgtaccttcggt
tttggtgccggtcgtgaagacgtctgggaaccggatctggatgttaactggggtgatgaa
aaagcctggctgactcaccgtcatccggaagcgctggcgaaagcaccgctgggtgcaacc
gagatgggtctgatttacgttaacccggaaggcccggatcacagcggcgaaccgctttct
gcggcagcagctatccgcgcgaccttcggcaacatgggcatgaacgacgaagaaaccgtg
gcgctgattgcgggtggtcatacgctgggtaaaacccacggtgccggtccgacatcaaat
gtaggtcctgatccagaagctgcaccgattgaagaacaaggtttaggttgggcgagcact
tacggcagcggcgttggcgcagatgccattacctctggtctggaagtagtctggacccag
acgccgacccagtggagcaactatttcttcgagaacctgttcaagtatgagtgggtacag
acccgcagcccggctggcgcaatccagttcgaagcggtagacgcaccggaaattatcccg
gatccgtttgatccgtcgaagaaacgtaaaccgacaatgctggtgaccgacctgacgctg
cgttttgatcctgagttcgagaagatctctcgtcgtttcctcaacgatccgcaggcgttc
aacgaagcctttgcccgtgcctggttcaaactgacgcacagggatatggggccgaaatct
cgctacatcgggccggaagtgccgaaagaagatctgatctggcaagatccgctgccgcag
ccgatctacaacccgaccgagcaggacattatcgatctgaaattcgcgattgcggattct
ggtctgtctgttagtgagctggtatcggtggcctgggcatctgcttctaccttccgtggt
ggcgacaaacgcggtggtgccaacggtgcgcgtctggcattaatgccgcagcgcgactgg
gatgtgaacgccgcagccgttcgtgctctgcctgttctggagaaaatccagaaagagtct
ggtaaagcctcgctggcggatatcatagtgctggctggtgtggttggtgttgagaaagcc
gcaagcgccgcaggtttgagcattcatgtaccgtttgcgccgggtcgcgttgatgcgcgt
caggatcagactgacattgagatgtttgagctgctggagccaattgctgacggtttccgt
aactatcgcgctcgtctggacgtttccaccaccgagtcactgctgatcgacaaagcacag
caactgacgctgaccgcgccggaaatgactgcgctggtgggcggcatgcgtgtactgggt
gccaacttcgatggcagcaaaaacggcgtcttcactgaccgcgttggcgtattgagcaat
gacttcttcgtgaacttgctggatatgcgttacgagtggaaagcgaccgacgaatcgaaa
gagctgttcgaaggccgtgaccgtgaaaccggcgaagtgaaatttacggccagccgtgcg
gatctggtgtttggttctaactccgtcctgcgtgcggtggcggaagtttacgccagtagc
gatgcccacgagaagtttgttaaagacttcgtggcggcatgggtgaaagtgatgaacctc
gaccgtttcgacctgctgtaa

DBGET integrated database retrieval system