KEGG   Escherichia coli K-12 W3110: JW4135Help
Entry
JW4135            CDS       T00068                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00230  Purine metabolism
ecj00250  Alanine, aspartate and glutamate metabolism
ecj01100  Metabolic pathways
Module
ecj_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    JW4135 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    JW4135 (purA)
Enzymes [BR:ecj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     JW4135 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: BAE78178
UniProt: P0A7D4
LinkDB All DBs
Structure
PDB: 

Position
4409367..4410665
Genome map
AA seq 432 aa AA seqDB search
MGNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGI
LRENVTSIIGNGVVLSPAALMKEMKELEDRGIPVRERLLLSEACPLILDYHVALDNAREK
ARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKAE
AVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVT
SSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGA
TTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTTP
LAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDR
TETMILRDPFDA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacaacgtcgtcgtactgggcacccaatggggtgacgaaggtaaaggtaagatc
gtcgatcttctgactgaacgggctaaatatgttgtacgctaccagggcggtcacaacgca
ggccatactctcgtaatcaacggtgaaaaaaccgttctccatcttattccatcaggtatt
ctccgcgagaatgtaaccagcatcatcggtaacggtgttgtgctgtctccggccgcgctg
atgaaagagatgaaagaactggaagaccgtggcatccccgttcgtgagcgtctgctgctg
tctgaagcatgtccgctgatccttgattatcacgttgcgctggataacgcgcgtgagaaa
gcgcgtggcgcgaaagcgatcggcaccaccggtcgtggtatcgggcctgcttatgaagat
aaagtagcacgtcgcggtctgcgtgttggcgaccttttcgacaaagaaaccttcgctgaa
aaactgaaagaagtgatggaatatcacaacttccagttggttaactactacaaagctgaa
gcggttgattaccagaaagttctggatgatacgatggctgttgccgacatcctgacttct
atggtggttgacgtttctgacctgctcgaccaggcgcgtcagcgtggcgatttcgtcatg
tttgaaggtgcgcagggtacgctgctggatatcgaccacggtacttatccgtacgtaact
tcttccaacaccactgctggtggcgtggcgaccggttccggcctgggcccgcgttatgtt
gattacgttctgggtatcctcaaagcttactccactcgtgtaggtgcaggtccgttcccg
accgaactgtttgatgaaactggcgagttcctctgcaagcagggtaacgaattcggcgca
actacggggcgtcgtcgtcgtaccggctggctggacaccgttgccgttcgtcgtgcggta
cagctgaactccctgtctggcttctgcctgactaaactggacgttctggatggcctgaaa
gaggttaaactctgcgtggcttaccgtatgccggatggtcgcgaagtgactaccactccg
ctggcagctgacgactggaaaggtgtagagccgatttacgaaaccatgccgggctggtct
gaatccaccttcggcgtgaaagatcgtagcggcctgccgcaggcggcgctgaactatatc
aagcgtattgaagagctgactggtgtgccgatcgatatcatctctaccggtccggatcgt
actgaaaccatgattctgcgcgacccgttcgacgcgtaa

DBGET integrated database retrieval system