KEGG   Escherichia coli 55989 (EAEC): EC55989_0624Help
Entry
EC55989_0624      CDS       T00826                                 

Gene name
dacA
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 5)
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck00550  Peptidoglycan biosynthesis
eck01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eck00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EC55989_0624 (dacA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:eck01002]
    EC55989_0624 (dacA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eck01011]
    EC55989_0624 (dacA)
Enzymes [BR:eck01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EC55989_0624 (dacA)
Peptidases and inhibitors [BR:eck01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   EC55989_0624 (dacA)
Peptidoglycan biosynthesis and degradation proteins [BR:eck01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   EC55989_0624 (dacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: CAU96496
UniProt: B7L9H6
LinkDB All DBs
Structure
PDB: 

Position
complement(678201..679412)
Genome map
AA seq 403 aa AA seqDB search
MNTIFSARIMKRLALTTALCTAFISAAHADDLNIKTMIPGVPQIDAESYILIDYNSGKVL
AEQNADVRRDPASLTKMMTSYVIGQAMKAGKFKETDLVTIGNDAWATGNPVFKGSSLMFL
KPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMNSYVNALGLKNTHFQTVH
GLDADGQYSSARDMALIGQALIRDVPNEYSIYKEKEFTFNGIRQLNRNGLLWDNSLNVDG
IKTGHTDKAGYNLVASATEGQMRLISAVMGGRTFKGREAESKKLLTWGFRFFETVNPLKV
GKEFASEPVWFGDSDRASLGVDKDVYLTIPRGRMKDLKASYVLNSSELHAPLQKNQVVGT
INFQLDGKTIEQRPLVVLQEIPEGNFFGKIIDYIKLMFHHWFG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaataccattttttccgctcgtatcatgaagcgcctggcgctcaccacggctctttgc
acagcctttatctctgctgcacatgccgatgacctgaatatcaaaactatgatcccgggt
gtaccgcagatcgatgcggagtcctacatcctgattgactataactccggcaaagtgctc
gccgaacagaacgcagatgtccgccgcgatcctgccagcctgaccaaaatgatgaccagt
tacgttatcggccaggcaatgaaagccggtaaatttaaagaaactgatttagtcactatc
ggcaacgacgcatgggccaccggtaacccggtgtttaaaggttcttcgctgatgttcctc
aaaccgggcatgcaggttccggtttctcagctgatccgcggtattaacctgcaatcgggt
aacgatgcttgtgtcgccatggccgattttgccgctggtagccaggacgcttttgttggc
ttgatgaacagctacgttaacgcactgggcctgaaaaatacccacttccagacggtacat
ggtctggatgctgatggtcagtacagctccgcgcgagatatggcgctgatcggccaggca
ttgatccgtgacgtaccgaatgaatactcgatctataaagaaaaagaatttacgtttaac
ggtattcgccagctgaaccgtaacggcctgttatgggataacagcctgaatgtcgacggc
atcaaaaccggacacactgacaaagcaggttacaaccttgttgcttctgcgactgaaggc
cagatgcgcttgatttctgcggtgatgggcggacgtacttttaaaggccgtgaagccgaa
agtaaaaaactgctaacctggggcttccgtttcttcgaaaccgttaacccactgaaagta
ggtaaagagttcgcctctgaaccggtttggtttggtgattctgatcgcgcttcgttaggg
gttgataaagacgtgtacctgaccattccacgtggtcgcatgaaagatctgaaagccagc
tatgtgctgaacagcagtgaattgcatgcgccgctgcaaaagaatcaggtcgtcggaact
atcaacttccagcttgatggcaaaacgatcgagcaacgcccgctggttgtgttgcaagaa
atcccggaaggtaacttcttcggcaaaatcattgattacattaaattaatgttccatcac
tggtttggttaa

DBGET integrated database retrieval system