KEGG   Escherichia coli 55989 (EAEC): EC55989_0708Help
Entry
EC55989_0708      CDS       T00826                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, FeS subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck00020  Citrate cycle (TCA cycle)
eck00190  Oxidative phosphorylation
eck00650  Butanoate metabolism
eck01100  Metabolic pathways
eck01110  Biosynthesis of secondary metabolites
eck01120  Microbial metabolism in diverse environments
eck01130  Biosynthesis of antibiotics
eck01200  Carbon metabolism
Module
eck_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eck_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eck_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eck00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EC55989_0708 (sdhB)
   00650 Butanoate metabolism
    EC55989_0708 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EC55989_0708 (sdhB)
Enzymes [BR:eck01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EC55989_0708 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     EC55989_0708 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: CAU96578
UniProt: B7LAD1
LinkDB All DBs
Structure
PDB: 

Position
772052..772768
Genome map
AA seq 238 aa AA seqDB search
MRLEFSIYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagactcgagttttcaatttatcgctataacccggatgttgatgatgctccgcgtatg
caggattacaccctggaagcggaagaaggtcgcgacatgatgttgctggatgcgcttatc
cagctgaaagagaaagatcccagcctgtcgttccgccgctcctgccgtgaaggtgtgtgc
ggttccgacggtctgaacatgaacggcaagaatggtctggcctgtattaccccgatttcg
gcactcaaccagccgggcaagaagattgtgattcgcccgctgccaggtttaccggtgatc
cgcgatttggtggtagacatgggacaattctatgcgcaatatgagaaaattaagccttac
ctgttgaataatggacaaaatccgccagctcgcgagcatttacagatgccagagcagcgc
gaaaaactcgacgggctgtatgaatgtattctctgcgcatgttgttcaacctcttgtccg
tctttctggtggaatcccgataagtttatcggcccggcaggcttgttagcggcatatcgt
ttcctgatcgatagccgtgataccgagactgacagccgcctcgacggtttgagcgatgca
ttcagtgtattccgctgtcacagcatcatgaactgcgtcagtgtatgtccgaaggggctg
aacccgacgcgcgccatcggccatatcaagtcgatgttgttgcaacgtaatgcgtaa

DBGET integrated database retrieval system