KEGG   Escherichia coli 55989 (EAEC): EC55989_1943Help
Entry
EC55989_1943      CDS       T00826                                 

Gene name
ydjJ
Definition
(GenBank) putative iditol dehydrogenase
Organism
eck  Escherichia coli 55989 (EAEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Cupin_2 ThiF
Motif
Other DBs
NCBI-ProteinID: CAU97802
UniProt: B7L6P9
LinkDB All DBs
Structure
PDB: 

Position
complement(2006221..2007198)
Genome map
AA seq 325 aa AA seqDB search
MPKEDEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQEIGLGHECAGTVVAVGSRVRKFK
PGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPNYRGALTHYLCHPESFTYKLPDN
MDTMEGALVEPAAVGMHAAMLADVKPGKKIIILGAGCIGLMTLQACKCLGATEIAVVDVL
EKRLIMAEQLGATVVINGTKEDTIARCQQFTEDMGADIVFETAGSAVTVKQAPYLVMRGG
KIMIVGTVPGDSAINFLKINREVTIQTVFRYANRYPVTIEAISSGRFDVKSMVTHIYDYR
DVQQAFEESVNNKRDIIKGVIKISD
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgcctaaagaagatgaagttttgattaaagtagaatatgtcggtatttgtggttcagat
gtacatggttttgaatcaggcccgtttattccgcctaaagacccaaatcaagaaattggc
ctgggtcatgaatgcgccgggacggttgtggctgtgggaagccgcgtgcgcaaatttaaa
ccgggggatcgggtaaatatcgaacctggcgttccttgcggtcactgtcgttactgtctg
gaaggcaaatataacatctgcccggacgttgattttatggcgacacaacccaactaccgc
ggcgcattaacgcactatctgtgtcatccggagagctttacttacaaactgccagacaat
atggacacgatggaaggggcgctggtggagcctgccgcagtcgggatgcatgccgcgatg
ctggcagatgttaaaccgggtaagaagataattattctgggagcaggttgtattggtttg
atgacgttgcaagcgtgcaaatgcctgggcgcaacggaaattgccgtcgttgatgtgctg
gaaaaacgtctgataatggcggaacaacttggtgcgacagtggttattaacggcacaaaa
gaagacactattgcacgctgtcagcaatttaccgaagacatgggcgcagatattgttttc
gaaacagcgggttctgcggtcaccgttaaacaggcaccttatctggtaatgcgcggcggt
aaaattatgattgttggtactgtacccggcgattcggcaatcaatttcctcaaaatcaat
cgcgaagtcactatccagacggtattccgctatgccaatcgttatccggtcacgattgaa
gctatttcttcagggcgattcgatgtgaaatcgatggtgacgcatatttacgattatcgg
gatgtacaacaggcatttgaagagtcagttaacaacaaacgcgacattattaaaggcgtt
attaaaattagcgattaa

DBGET integrated database retrieval system