KEGG   Escherichia coli 55989 (EAEC): EC55989_2437Help
Entry
EC55989_2437      CDS       T00826                                 

Gene name
rsuA
Definition
(GenBank) 16S rRNA pseudouridylate 516 synthase
  KO
K06183  16S rRNA pseudouridine516 synthase [EC:5.4.99.19]
Organism
eck  Escherichia coli 55989 (EAEC)
Brite
KEGG Orthology (KO) [BR:eck00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:eck03009]
    EC55989_2437 (rsuA)
Enzymes [BR:eck01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.19  16S rRNA pseudouridine516 synthase
     EC55989_2437 (rsuA)
Ribosome biogenesis [BR:eck03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    EC55989_2437 (rsuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: CAU98307
UniProt: B7LAK7
LinkDB All DBs
Structure
PDB: 

Position
complement(2495188..2495883)
Genome map
AA seq 231 aa AA seqDB search
MRLDKFIAQQLGVSRAIAGREIRGNRVTVDGEIVRNAAFKLLPEHDVAYDGNPLAQQHGP
RYFMLNKPQGYVCSTDDPDHPTVLYFLDEPVAWKLHAAGRLDIDTTGLVLMTDDGQWSHR
ITSPRHHCEKTYLVTLESPVADDTAEQFAKGVQLHNEKDLTKPAVLEVITPTQVRLTISE
GRYHQVKRMFAAVGNHVVELHRERIGGITLDADLAPGEYRPLTEEEIASVV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttgataaatttatcgcacagcaactcggcgttagccgtgctattgccgggcgt
gaaatccgcggcaatcgtgtcaccgtcgatggcgaaatcgtccgtaatgcagcgttcaaa
ctgcttcctgaacatgatgtcgcttacgatggcaacccgctggcgcagcaacacggtcca
cgttacttcatgctcaataagcctcagggctatgtttgctccacggacgaccctgatcac
ccaacggtgctctattttcttgatgaaccggtagcgtggaaactgcatgcggcggggcgg
ttggatattgataccaccggtctggtgctgatgactgatgatggtcagtggtcgcaccgc
attacttctccgcgccatcattgcgagaagacctatctggtgacactggaatcacctgta
gctgacgatacggcagagcaatttgctaaaggcgtgcagctgcataacgaaaaagatctc
actaagcctgcggtgctggaagtgattaccccaacgcaggttcgtctgaccatcagcgaa
gggcgttatcatcaggtgaaacgcatgttcgccgccgtgggtaaccacgtggttgagctg
catcgtgaacgtattggcggtattacgctggatgctgatttagcccccggtgaatatcgt
ccgttaactgaagaagaaattgccagcgtcgtctaa

DBGET integrated database retrieval system