KEGG   Escherichia coli 55989 (EAEC): EC55989_2506Help
Entry
EC55989_2506      CDS       T00826                                 

Gene name
yfbJ
Definition
(GenBank) conserved hypothetical protein; putative inner membrane protein
  KO
K12963  undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnF
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:eck00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    EC55989_2506 (yfbJ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:eck01005]
    EC55989_2506 (yfbJ)
Lipopolysaccharide biosynthesis proteins [BR:eck01005]
 Unusual sugar
  EC55989_2506 (yfbJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Multi_Drug_Res EamA 7TM-7TMR_HD
Motif
Other DBs
NCBI-ProteinID: CAU98374
UniProt: B7LAS4
LinkDB All DBs
Position
2574915..2575301
Genome map
AA seq 128 aa AA seqDB search
MGLMWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLS
VFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIF
LPMTKQRY
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgatgtggggattattcagcgtcattattgcctcagttgcgcaattaagcctg
ggttttgcggcgagtcatctgccgccgatgacgcacttatgggattttatcgcggctctg
ttagcttttggcctggatgcccggatactgttactcgggctgctgggttatctgctttcc
gttttttgttggtataaaacgctacataaacttgcgctaagcaaagcctatgccttgctc
agtatgagttatgtgctggtatggattgcttcaatggtacttcccggctgggaagggact
ttttcgctgaaagcactactgggagtagcctgtattatgagcgggttgatgctgattttc
ctgcccatgacaaaacaacgttactga

DBGET integrated database retrieval system