KEGG   Escherichia coli 55989 (EAEC): EC55989_2573Help
Entry
EC55989_2573      CDS       T00826                                 

Gene name
aroC
Definition
(GenBank) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eck01100  Metabolic pathways
eck01110  Biosynthesis of secondary metabolites
eck01130  Biosynthesis of antibiotics
eck01230  Biosynthesis of amino acids
Module
eck_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:eck00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EC55989_2573 (aroC)
Enzymes [BR:eck01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     EC55989_2573 (aroC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: CAU98441
UniProt: B7LBI3
LinkDB All DBs
Position
complement(2644027..2645112)
Genome map
AA seq 361 aa AA seqDB search
MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRR
EPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDY
RGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLEIKDWSLVEQNPFFC
PDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSINAV
KGVEIGDGFDVVALRGSQNRDEITKDGFQSNHAGGILGGISSGQQIIAHMALKPTSSITV
PGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQRAQNADVKTDIPR
W
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggctggaaacacaattggacaactctttcgcgtaaccaccttcggcgaatcgcatggg
ctggcgctcggctgcatcgtcgatggtgttccgccaggcattccgctgacggaagcggac
ctgcaacatgacctcgaccgtcgtcgccctgggacatcgcgctataccacccagcgccgc
gagccggatcaggtcaaaattctctccggtgtttttgaaggcgttactactggcaccagc
attggcttgttgatcgaaaacactgaccagcgctctcaggattacagcgcaattaaagac
gttttccgcccaggccatgctgattacacctacgaacaaaaatacggtctgcgcgattat
cgcggcggtggacgttcttccgcccgcgaaaccgccatgcgcgtggcggcaggggcgatt
gccaaaaaatatctcgccgagaaatttggtattgaaatccgcggctgcttgacccagatg
ggcgacattccgctggaaatcaaagactggtcgctggttgaacaaaatccgttcttctgc
ccggaccccgacaaaatcgacgcgttagatgaactgatgcgcgcgctgaaaaaagagggc
gactccatcggcgcgaaagtcaccgttgttgccagtggtgtccccgccggacttggcgag
ccggtctttgaccgcctggatgccgacatcgcccatgcgctgatgagcatcaacgcggtg
aaaggcgtggaaattggcgacggttttgacgtagtggcgctgcgcggcagccagaaccgc
gacgaaatcaccaaagacggtttccagagcaaccatgcgggcggcattctcggcggtatc
agcagcgggcagcaaatcattgctcatatggcgctgaaaccgacctccagcattaccgtg
ccggggcgcactattaaccgctttggcgaagaagttgagatgatcaccaaaggccgtcac
gatccctgtgtcgggatccgtgcagtgccgatcgctgaagcgatgctggcgatcgtttta
atggatcacctgttacggcagcgggcgcaaaatgccgatgtgaagactgatattccacgc
tggtaa

DBGET integrated database retrieval system