KEGG   Escherichia coli ATCC 8739: EcolC_0064
Entry
EcolC_0064        CDS       T00697                                 

Definition
(GenBank) DNA ligase (NAD(+))
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl03030  DNA replication
ecl03410  Base excision repair
ecl03420  Nucleotide excision repair
ecl03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EcolC_0064
   03410 Base excision repair
    EcolC_0064
   03420 Nucleotide excision repair
    EcolC_0064
   03430 Mismatch repair
    EcolC_0064
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ecl03032]
    EcolC_0064
   03400 DNA repair and recombination proteins [BR:ecl03400]
    EcolC_0064
Enzymes [BR:ecl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     EcolC_0064
DNA replication proteins [BR:ecl03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     EcolC_0064
DNA repair and recombination proteins [BR:ecl03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     EcolC_0064
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     EcolC_0064
   MMR (mismatch excision repair)
    DNA ligase
     EcolC_0064
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EcolC_0064
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB
Other DBs
NCBI-ProteinID: ACA75750
UniProt: B1IYV3
LinkDB
Position
70603..72285
AA seq 560 aa
MKVWMAILISILCWQSSVWAVCPAWSPARAQEEISRLQQQIKQWDDDYWKEGKSEVEDGV
YDQLSARLTQWQRCFGSEPRDVMMPPLNGAVMHPVAHTGVRKMVDKNALSLWMRERSDLW
VQPKVDGVAVTLVYRDGKLNKAISRGNGLKGEDWTQKVSLISAVPQTVSGPLANSTLQGE
IFLQREGHIQQQMGGINARAKVAGLMMRQDDSDTLNSLGVFVWAWPDGPQLMSDRLKELA
TAGFTLTQTYTRAVKNADEVARVRNEWWKAELPFVTDGVVVRAAKEPESRHWLPGQAEWL
VAWKYQPVAQVAEVKAIQFAVGKSGKISVVASLAPVMLDDKKVQRVNIGSVRRWQEWDIA
PGDQILVSLAGQGIPRIDDVVWRGAERTKPTPPENRFNSLTCYFASDVCQEQFISRLVWL
GAKQVLGLDGIGEAGWRALHQTHRFEHIFSWLLLTPEQLQNTPGIAKSKSAQLWHQFNLA
RKQPFTRWVMAMGIPLTRAALNASDERSWSQLLFSTEQFWQQLPGTGSGRARQVIEWKEN
AQIKKLGSWLAAQQITGFEP
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgaaagtatggatggcgatattaataagtatcttgtgctggcaatcatctgtgtgggcg
gtctgtccggcctggtcgccagccagagcacaggaagaaatttcccgcctgcaacagcaa
ataaaacagtgggacgatgactactggaaggaaggaaaaagtgaggtggaagacggtgtt
tacgatcagttaagcgcccgtcttacgcagtggcaacgctgctttgggagcgagccccgc
gacgtgatgatgccgcctttaaatggtgcggttatgcatccggttgcccatacgggtgta
cgcaaaatggtggataaaaacgcattaagtctgtggatgcgagaacgtagcgatctttgg
gtgcagccaaaagttgatggcgttgcggtaaccctggtttatcgggacgggaaactgaac
aaagcaatcagtcgcggtaatggcctgaaaggcgaggactggacgcagaaagttagctta
atttccgctgtgccgcaaaccgttagcgggcctttagccaacagtacgcttcagggggaa
atatttctccagcgcgaggggcatatccaacaacaaatggggggaataaatgcccgcgca
aaagttgctggcttgatgatgcgccaggacgatagcgacacgctgaattctctgggcgtt
tttgtctgggcatggccggatggaccgcagttaatgtctgatcgtttaaaagagctggct
accgcaggttttactctaacgcagacgtatacccgtgcggtgaaaaatgctgatgaagtt
gcgcgcgtacgcaatgagtggtggaaagcggaattacccttcgtcaccgatggcgtagtt
gtacgagcggcgaaagagccagaatcccgccattggctaccgggccaggcagagtggctg
gtggcctggaaatatcaacctgtagctcaggttgccgaagtgaaggcaattcagtttgcg
gtgggtaagagcggtaaaatatcggtggttgcgtcactcgcacctgtcatgctggatgat
aaaaaagtccagcgggtgaatattggttccgtcaggcgctggcaggagtgggatattgcg
cctggtgatcagattctcgtcagccttgccggtcagggtattcctcgcattgatgatgtg
gtgtggcgcggtgcagaacgtacaaaaccgacaccgccagaaaaccgctttaactcgttg
acctgctactttgcttctgatgtttgtcaggaacagttcatttcacgcttagtctggctg
ggggcaaaacaggttcttgggctggatggcattggtgaggccggctggcgcgcgctgcat
cagactcatcgctttgagcatatcttttcctggcttttattaacgccagagcaattacag
aacacgccggggatcgcgaaaagtaaaagtgcgcagctatggcatcagtttaatctggct
cgtaagcagccttttactcgctgggtgatggcaatgggaataccgctaacccgggcggcg
cttaatgccagtgatgaacggtcctggtcgcaacttttatttagcacggagcagttctgg
cagcagctgccgggcactggatcggggcgcgccagacaggttattgaatggaaggaaaat
gcgcaaatcaagaagctgggcagttggctggctgcccagcagatcacaggttttgaacct
tag

KEGG   Escherichia coli ATCC 8739: EcolC_1267
Entry
EcolC_1267        CDS       T00697                                 

Definition
(GenBank) DNA ligase, NAD-dependent
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl03030  DNA replication
ecl03410  Base excision repair
ecl03420  Nucleotide excision repair
ecl03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EcolC_1267
   03410 Base excision repair
    EcolC_1267
   03420 Nucleotide excision repair
    EcolC_1267
   03430 Mismatch repair
    EcolC_1267
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ecl03032]
    EcolC_1267
   03400 DNA repair and recombination proteins [BR:ecl03400]
    EcolC_1267
Enzymes [BR:ecl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     EcolC_1267
DNA replication proteins [BR:ecl03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     EcolC_1267
DNA repair and recombination proteins [BR:ecl03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     EcolC_1267
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     EcolC_1267
   MMR (mismatch excision repair)
    DNA ligase
     EcolC_1267
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EcolC_1267
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 HHH_5 BRCT DNA_ligase_ZBD PTCB-BRCT HHH RNA_ligase DZR_2 PUA_2 Zn-ribbon_8
Other DBs
NCBI-ProteinID: ACA76933
UniProt: B1IX60
LinkDB
Structure
PDB: 
5TT5 4GLX 2OWO

Position
1385059..1387074
AA seq 671 aa
MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQ
RVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKNNEKVTWCCELKLDGLA
VSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVFLPQAG
FEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGELPDTHL
GRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLAQQEQL
GFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSNATLHN
ADEIERLGLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVFPTHCPVCGSDVERVEG
EAVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKIIDQLVEKEYVHTPADLFKLTAG
KLTGLERMGPKSAQNVVNALEKAKETTFARFLYALGIREVGEATAAGLAAYFGTLEALEA
ASIEELQKVPDVGIVVASHVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAG
KTVVLTGSLSQMSRDDAKARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVI
DEAEMLRLLGS
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggaatcaatcgaacaacaactgacagaactgcgaacgacgcttcgccatcatgaatat
ctttatcatgtgatggatgcgccggaaattcccgacgctgaatacgacaggctgatgcgc
gaactgcgcgagctggaaaccaaacatccagaactgattacgcctgattcgcctactcaa
cgtgtaggcgctgcgccgctggcggctttcagccagatacgccatgaagtaccaatgctg
tcactggataacgtttttgatgaagaaagctttcttgctttcaacaaacgtgtgcaggac
cgtctgaaaaacaacgagaaagtcacctggtgctgtgagctgaagctggatggccttgcc
gtcagtattctgtatgaaaatggcgttttagtcagtgccgcgacccgtggcgatggcacc
accggggaagatatcacgtctaatgtgcgtactattcgcgccattccgctgaagctgcac
ggagagaatatcccggcgcgtctggaagtgcgtggtgaagtgttcctgccgcaggcgggg
ttcgaaaagattaacgaagatgcgcgacgcacgggcgggaaagtttttgctaacccacgt
aatgcggcagctggttcactgcgtcagcttgatccgcgtattacagcgaagcgaccgctc
acttttttctgctatggcgttggtgttctggaaggtggcgagctgccggatactcatctt
ggccgtttactgcaatttaaaaagtgggggttgccggtcagcgatcgggtaacgctttgt
gaatcggcggaagaagtgctggcgttctatcacaaagtggaagaagaccgcccgacgctg
ggctttgatatcgacggcgtggtgattaaggtcaactcactggcacagcaggagcagctt
ggctttgtcgcgcgtgccccgcgctgggcggtagcgtttaaattcccggcgcaggagcag
atgacctttgtgcgtgacgtcgagtttcaggttgggcgtactggcgcgattacgcctgtt
gcgcgtctggaacctgtccatgttgctggcgtgctggtgagtaacgcaaccttacacaat
gcggatgaaatcgaacgtcttggtttacgcattggcgataaagtggtgattcgccgcgct
ggcgacgtgatcccgcaggtggttaacgtcgtgctttctgaacgcccggaagatacccgt
gaggttgtattcccgacgcattgtccggtatgtggttctgacgttgagcgtgtggaaggt
gaagcggttgcccgctgtaccggtggcctgatttgcggtgcgcagcgtaaagagtcgctg
aaacactttgtttcccgccgtgcgatggatgttgacggaatgggcgacaaaatcatcgat
cagctggttgaaaaagaatatgtccatactccggcagatctgttcaaactcaccgcaggc
aaactgaccggactggagcgtatggggccaaaatcggcacaaaacgtggttaacgcgctg
gaaaaagcgaaagaaaccacctttgctcgcttcctctatgcacttggcatccgtgaagtc
ggcgaggccaccgcagcaggtctggcggcatatttcggcacgctggaagcgctggaagcc
gcttcgattgaagagctgcaaaaggtgcctgatgttggcattgtcgttgcatcccacgtt
cacaacttctttgccgaagaaagcaaccgcaatgtcatcagcgagctgttggcggaaggt
gttcactggcctgcgccgatcgttatcaacgcggaagagattgacagcccgtttgctggt
aaaaccgtggtgcttacgggcagcttaagccagatgtcgcgtgatgacgctaaagctcga
ctggttgaactgggcgcgaaagtcgcgggcagcgtgtcgaagaaaaccgatctggtgatt
gccggagaagcggcaggttctaaactggcgaaagcgcaggaactgggcattgaagtcatc
gacgaagcggaaatgctgcgtttgctgggtagctga

DBGET integrated database retrieval system