KEGG   Escherichia coli ATCC 8739: EcolC_1726
Entry
EcolC_1726        CDS       T00697                                 

Definition
(GenBank) excinuclease ABC, C subunit
  KO
K03703  excinuclease ABC subunit C
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    EcolC_1726
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ecl03400]
    EcolC_1726
DNA repair and recombination proteins [BR:ecl03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     EcolC_1726
SSDB
Motif
Pfam: UvrC_HhH_N GIY-YIG HHH UVR HHH_5 HHH_3 HHH_2
Other DBs
NCBI-ProteinID: ACA77376
UniProt: B1IZZ1
LinkDB
Structure
PDB: 
1KFT

Position
1921985..1923817
AA seq 610 aa
MSDQFDAKAFLKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALV
AQIQQIDVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSGDTHPRLAMHRG
AKHAKGEYFGPFPNGYAVRETLALLQKIFPIRQCENSVYRNRSRPCLQYQIGRCLGPCVE
GLVSEEEYAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVT
EKQFVSNTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFV
GQFYLQGSQMRTLPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLART
NAATALTSKLSQQSTVHQRLTALASVLKLPEVKRMECFDISHTMGEQTVASCVVFDANGP
LRAEYRRYNITGITPGDDYAAMNQVLRRRYGKAIDDSKIPDVILIDGGKGQLAQAKNVFA
ELDVSWDKNHPLLLGVAKGVDRKAGLETLFFEPEGEGFSLPPDSPALHVIQHIRDESHDH
AIGGHRKKRAKVKNTSSLETIEGVGPKRRQMLLKYMGGLQGLRNASVEEIAKVPGISQGL
AEKIFWSLKH
NT seq 1833 nt   +upstreamnt  +downstreamnt
gtgagtgatcagtttgacgcaaaagcgtttttaaaaaccgtaaccagccagccaggcgtt
tatcgcatgtacgatgctggtggtacggttatctatgtcggcaaagcgaaagacctgaaa
aaacggctttccagctatttccgtagcaacctcgcttcgcgcaaaaccgaagcgctggtc
gcccagatccagcaaattgatgtaacggttactcatacagaaaccgaagcgctgttgctg
gaacacaactacatcaaactctatcagccgcgttacaacgttttactacgcgatgataaa
tcttatccctttatcttcctgagtggcgatacccatccgcgtctggcgatgcatcgtggt
gcgaagcatgctaaaggtgaatatttcggcccgttcccgaatggctatgccgtacgtgaa
acactggcgctactgcaaaagattttccccattcgccagtgcgaaaacagtgtttatcgc
aatcgctcgcgtccgtgtctgcaatatcagataggacgttgtctggggccgtgcgttgaa
ggactggtgagtgaagaagaatacgctcagcaggtcgagtatgtgcgcctgtttttgtct
ggcaaagatgatcaggtgcttacgcaactgattagccgtatggaaactgccagccagaat
ctggagtttgaagaagctgcacgtattcgcgaccaaattcaggcggtgcgacgcgtcacc
gaaaaacagtttgtttccaataccggcgacgaccttgacgttattggtgtggcgttcgat
gcgggcatggcttgtgtccacgtattgttcattcgtcagggcaaagtgctcggcagccgc
agctatttcccgaaagtgcctggcggtacggaactgagcgaggtggtggaaaccttcgta
ggtcagttctatttacaaggcagccagatgcgcaccttaccgggtgagatcctgctcgat
tttaatcttagcgataaaacgctgctcgccgattccctttcagaactggcgggacgcaag
attaatgttcaaaccaaacctcgcggcgatagggcgcgttatctgaaactcgcgcgcacc
aatgcggcgacggccttaaccagcaaactttcgcagcaatctaccgttcaccagcggctt
acagcacttgccagtgtgttgaaattgccggaagtgaagcggatggagtgctttgacatc
agccataccatgggtgaacaaaccgtcgcttcctgtgtggtgtttgatgctaacggcccg
ctgcgtgcggagtatcggcgctataacattactggcatcacgccgggcgatgattatgcg
gcgatgaatcaggtgctgcgtcggcgttatggtaaagccatcgacgacagtaagatcccg
gatgtgatacttatcgacggcggcaaaggccagcttgcgcaggcgaaaaatgtcttcgcc
gaactggatgtctcatgggataaaaatcatccgctgctacttggcgttgccaaaggagta
gatcgtaaggctgggctggaaacgctgttctttgagccggaaggtgagggattcagtttg
ccgccagattctcccgcgctgcatgttatccagcatattcgcgatgaatcacacgatcac
gcgattggcgggcaccgtaaaaaacgggcgaaggtcaaaaataccagttccctggaaacc
attgaaggcgtcgggccaaaacgccggcaaatgttgttgaaatatatgggcggtttgcaa
ggtttacgtaacgccagcgtcgaggaaattgcaaaagtgccgggtatttcgcaaggtctg
gcagaaaagatcttctggtcgttgaaacattga

DBGET integrated database retrieval system