KEGG   Escherichia coli ATCC 8739: EcolC_2487
Entry
EcolC_2487        CDS       T00697                                 

Definition
(GenBank) transcription-repair coupling factor
  KO
K03723  transcription-repair coupling factor (superfamily II helicase) [EC:3.6.4.-]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    EcolC_2487
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ecl03400]
    EcolC_2487
Enzymes [BR:ecl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     EcolC_2487
DNA repair and recombination proteins [BR:ecl03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     TRCF (transcription-repair coupling factor)
      EcolC_2487
SSDB
Motif
Pfam: TRCF UvrB_inter CarD_CdnL_TRCF DEAD Helicase_C ResIII UB2H ERCC3_RAD25_C
Other DBs
NCBI-ProteinID: ACA78118
LinkDB
Structure
PDB: 
3HJH 2B2N 4DFC 2EYQ

Position
2735869..2739363
AA seq 1164 aa
MPPYVEAYPNENLTTVMPEQYRYTLPVKAGEQRLLGELTGAACATLVAEIAERHAGPVVL
IAPDMQNALRLHDEISQFTDQMVMNLADWETLPYDSFSPHQDIISSRLSTLYQLPTMQRG
VLIVPVNTLMQRVCPHSFLHGHALVMKKGQRLSRDALRTQLDSAGYRHVDQVMEHGEYAT
RGALLDLFPMGSELPYRLDFFDDEIDSLRVFDVDSQRTLEEVEAINLLPAHEFPTDKAAI
ELFRSQWRDTFEVKRDPEHIYQQVSKGTLPAGIEYWQPLFFSEPLPPLFSYFPANTLLVN
TGDLETSAERFQADTLARFENRGVDPMRPLLPPQSLWLRVDELFSELKNWPRVQLKTEHL
PTKAANANLGFQKLPDLAVQAQQKAPLDALRKFLETFDGPVVFSVESEGRREALGELLAR
IKIAPQRIMRLDEASDRGRYLMIGAAEHGFVDTVRNLALICESDLLGERVARRRQDSRRT
INPDTLIRNLAELHIGQPVVHLEHGVGRYAGMTTLEAGGITGEYLMLTYANDAKLYVPVS
SLHLISRYAGGAEENAPLHKLGGDAWSRARQKAAEKVRDVAAELLDIYAQRAAKEGFAFK
HDREQYQLFCDSFPFETTPDQAQAINAVLSDMCQPLAMDRLVCGDVGFGKTEVAMRAAFL
AVDNHKQVAVLVPTTLLAQQHYDNFRDRFANWPVRIEMISRFRSAKEQTQILAEVAEGKI
DILIGTHKLLQSDVKFKDLGLLIVDEEHRFGVRHKERIKAMRANVDILTLTATPIPRTLN
MAMSGMRDLSIIATPPARRLAVKTFVREYDSLVVREAILREILRGGQVYYLYNDVENIQK
AAERLAELVPEARIAIGHGQMRERELERVMNDFHHQRFNVLVCTTIIETGIDIPTANTII
IERADHFGLAQLHQLRGRVGRSHHQAYAWLLTPHPKAMTTDAQKRLEAIASLEDLGAGFA
LATHDLEIRGAGELLGEEQSGSMETIGFSLYMELLENAVDALKAGREPSLEDLTSQQTEV
ELRMPSLLPDDFIPDVNTRLSFYKRIASAKTENELEEIKVELIDRFGLLPDPARTLLDVA
RLRQQAQKLGIRKLEGNEKGGVIEFAEKNHVNPAWLIGLLQKQPQHYRLDGPTRLKFIQD
LSERKTRIEWVRQFMRELEENAIA
NT seq 3495 nt   +upstreamnt  +downstreamnt
atgcccccatatgttgaggcatatcctaacgagaatctgacaaccgttatgcctgaacaa
tatcgttatacgctgcccgtcaaagcgggtgagcagcgtctgctgggcgagttaaccggc
gcagcctgtgcaacgctggtagcggaaattgccgaacgtcacgccggtccggtggtactc
attgcaccagatatgcaaaatgctctgcgtttgcatgatgaaatcagccagttcaccgat
cagatggtgatgaatctggcggactgggaaactcttccctacgacagtttttcgcctcat
caggacattatctcctcgcgcctttccaccctttaccagctaccgacgatgcagcgtggc
gtactgattgttccggtgaatacgcttatgcagcgcgtttgcccacacagttttctccac
ggtcatgcgctggtgatgaaaaaaggtcagcgcctgtcacgagatgcattacgaacccaa
ctggacagcgccggttatcgccatgttgaccaggtgatggagcacggcgaatacgccacg
cgcggcgcgttgctggatctcttcccgatggggagtgagctgccttatcgtcttgatttc
tttgatgatgaaatcgacagcctgcgggtgtttgacgtcgacagccagcgcacgctggag
gaagtagaagcgatcaatctgctgcccgcgcacgaatttccgaccgataaagcggcaatt
gaactgttccgcagccagtggcgcgataccttcgaagtgaagcgcgatccggaacatatt
taccagcaagtgagtaaaggcacattacctgccgggatcgagtactggcagccattgttc
ttcagcgaaccactgccgccgctgttcagttatttccctgccaataccttgctggtgaat
actggcgatctggaaaccagtgccgaacgtttccaggctgacacgctggcgcgttttgag
aatcgcggcgtcgatccgatgcgcccgctgttgccaccacaatcgctctggctgcgggtg
gacgagctcttctcagagctgaaaaactggccccgggtgcagctaaaaactgaacattta
ccgacaaaagccgcgaatgccaatttaggtttccagaaactgccagacctggccgttcag
gcgcaacaaaaagcgccgctggatgcgctgcgtaagttcctcgagactttcgacggtccg
gtggtgttctcggtagaaagtgaaggtcgccgtgaagcgctgggtgaactgctcgcacga
attaaaattgctccgcaacgcattatgcgtcttgatgaagccagcgaccgtgggcgttat
ctgatgattggcgctgccgaacatggttttgtcgatacggtgcgtaatctggcgctgatc
tgcgaaagcgatctgctcggtgaacgtgttgcccgccgtcgtcaggattctcgccgcacc
atcaaccccgatacactgatccgtaaccttgcggagctgcatattggtcagccggtggtc
catctggagcacggtgtcgggcgctatgccggaatgaccacgctcgaagcgggcggcatt
actggcgagtatttgatgctcacctatgccaacgacgccaaactgtatgttccggtgtcg
tcactgcatctgattagccgttacgcaggtggcgcggaagaaaacgccccgctgcataaa
cttggcggcgatgcgtggtcacgcgcgcggcagaaagcggcggaaaaagtgcgtgatgtg
gcggcggaattgctggatatctacgcgcaacgcgccgccaaagagggcttcgcgtttaaa
cacgatcgtgagcagtatcagttgttctgcgacagcttcccgtttgaaaccacgccggat
caggcgcaggccattaatgcggtacttagcgacatgtgtcagccgctggcaatggatcgt
ctggtgtgcggcgatgttggctttggtaaaacagaagtggcgatgcgcgccgctttcctg
gcagtagataaccacaagcaggtagcggtgttggtgcctaccacccttcttgcgcagcag
cattacgacaacttccgcgaccgtttcgccaactggccggtacgtatcgaaatgatctcc
cgtttccgcagcgccaaagagcagacgcaaatccttgcggaagtggcggaagggaaaatc
gatattctgatcggtacgcacaaactgctgcaaagtgacgtcaagtttaaagatttaggc
ctgctgattgtcgatgaagaacaccgcttcggggtgcgtcataaagagcgcattaaagcg
atgcgcgcgaacgtggatattctgacgcttactgcaacgccgatcccacgcacgctgaat
atggcaatgagcggaatgcgtgacctgtcgattatcgccacgccgcccgcccgtcgtctg
gcagttaaaacctttgtccgtgagtatgacagcctggtggtccgggaggcgatcctgcgt
gaaattttgcgcggggggcaggtttattatctctacaatgatgtggaaaacatccagaaa
gctgccgaacggctggcagaactggtgcctgaagcacggattgccatcggtcacgggcag
atgcgcgagcgcgaactggaacgggtgatgaatgatttccatcatcaacgtttcaacgtg
ctggtttgtaccaccattatcgaaaccgggatcgacatcccgacagccaacaccattatc
attgaacgtgcggatcacttcggtctggcgcagctgcaccagttacgcggtcgcgtcgga
cgttcacatcatcaggcatatgcatggctgctgacgccgcatccaaaagcgatgactacc
gatgcacaaaaacgtcttgaagcgattgcctcgctggaagatctcggtgcaggctttgcg
ctggcaacgcacgatctggagatccgcggcgcgggtgaactgcttggcgaagaacaaagt
ggctcaatggaaaccatcggtttctcgctgtatatggagttgctggaaaacgccgtcgat
gcactgaaagccggacgcgagccgtcgctggaagatctcaccagccagcaaacagaagtc
gagctgcggatgccgtcgctattgccagatgatttcattcctgacgtgaatacgcgtttg
tcgttctataaacgtattgccagcgccaaaacggaaaacgaactggaagagatcaaagtc
gagcttatcgatcgcttcggcctgctgccggatccggcgcgtaccctgctggatgttgcc
cgtctgcgccagcaagcgcagaaactggggatcaggaagctggaaggtaatgagaaaggc
ggggtgatcgaatttgccgagaagaatcacgttaatccggcctggttgattggtttgctg
caaaaacagccgcagcattaccgccttgatggtccgacgcgcctgaaatttattcaggat
ttgagtgagcggaaaacgcgtatcgaatgggtacgccagtttatgcgtgaactggaagag
aacgcgatcgcttaa

DBGET integrated database retrieval system