KEGG   Escherichia coli ATCC 8739: EcolC_2642Help
Entry
EcolC_2642        CDS       T00697                                 

Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl00061  Fatty acid biosynthesis
ecl01100  Metabolic pathways
ecl01212  Fatty acid metabolism
Module
ecl_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    EcolC_2642
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecl01004]
    EcolC_2642
Enzymes [BR:ecl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     EcolC_2642
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     EcolC_2642
Lipid biosynthesis proteins [BR:ecl01004]
 Fatty acid synthase
  Component type
   EcolC_2642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ACA78272
UniProt: B1IVX8
LinkDB All DBs
Structure
PDB: 

Position
2893890..2894408
Genome map
AA seq 172 aa AA seqDB search
MVDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELD
INPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLP
TAKKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDLKVGLFQDTSAF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaacgcgaatcctatacaaaagaagaccttcttgcctctggtcgcggtgaa
ctgtttggcgctaaaggcccgcaattgccagcaccgaacatgctgatgatggaccgtgtg
gtcaaaatgaccgaaacgggtggtaacttcgacaaagggtatgttgaagcagaactggat
atcaatccggatctgtggttcttcggatgccactttattggcgatccggttatgccggga
tgcctgggcctggacgcaatgtggcagctggtagggttctacctcggctggctgggcggc
gaaggtaaaggccgcgcgctgggcgttggcgaagtgaaattcactggtcaggtactgccg
acagcgaaaaaagtgacctaccgtattcactttaaacgcattgttaaccgtcgtctgatt
atgggcctggcggatggcgaagtgctggttgatggtcgtctgatctataccgccagcgac
ctgaaagtcggtctgttccaggatacgtctgccttctga

DBGET integrated database retrieval system