KEGG   Escherichia coli ATCC 8739: EcolC_2864
Entry
EcolC_2864        CDS       T00697                                 

Definition
(GenBank) excinuclease ABC, B subunit
  KO
K03702  excinuclease ABC subunit B
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    EcolC_2864
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ecl03400]
    EcolC_2864
DNA repair and recombination proteins [BR:ecl03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     EcolC_2864
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      EcolC_2864
SSDB
Motif
Pfam: UvrB_inter UvrB Helicase_C ResIII UVR DEAD AAA_30 UB2H IF2_N
Other DBs
NCBI-ProteinID: ACA78492
UniProt: B1IXI9
LinkDB
Structure
PDB: 
1QOJ 1E52

Position
complement(3130854..3132875)
AA seq 673 aa
MSKPFKLNSAFKPSGDQPEAIRRLEEGLEDGLAHQTLLGVTGSGKTFTIANVIADLQRPT
MVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYYDYYQPEAYVPSSDTFIEKDASVNEHIE
QMRLSATKAMLERRDVVVVASVSAIYGLGDPDLYLKMMLHLTVGMIIDQRAILRRLAELQ
YARNDQAFQRGTFRVRGEVIDIFPAESDDIALRVELFDEEVERLSLFDPLTGQIVSTIPR
FTIYPKTHYVTPRERIVQAMEEIKEELAARRKVLLENNKLLEEQRLTQRTQFDLEMMNEL
GYCSGIENYSRFLSGRGPGEPPPTLFDYLPADGLLVVDESHVTIPQIGGMYRGDRARKET
LVEYGFRLPSALDNRPLKFEEFEALAPQTIYVSATPGNYELEKSGGDVVDQVVRPTGLLD
PIIEVRPVATQVDDLLSEIRQRAAINERVLVTTLTKRMAEDLTEYLEEHGERVRYLHSDI
DTVERMEIIRDLRLGEFDVLVGINLLREGLDMPEVSLVAILDADKEGFLRSERSLIQTIG
RAARNVNGKAILYGDKITPSMAKAIGETERRREKQQKYNEEHGITPQGLNKKVVDILALG
QNIAKTKAKGRGKSRPIVEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAAQIRD
QLHQLRELFIAAS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgagtaaaccgttcaaactgaattccgcttttaaaccttctggcgatcagccagaggcg
attcgacgtctcgaagaggggctggaagatggcctggcgcaccagacgttacttggcgtg
actggctcagggaaaaccttcaccattgccaatgtcattgctgaccttcagcgcccaacc
atggtacttgcgcccaacaaaacgctggcggcccagctgtatggcgaaatgaaagagttc
ttcccggaaaacgcggtggaatatttcgtttcctactacgactactatcagccggaagcc
tatgtaccgagttccgacactttcattgagaaagatgcctcggttaacgaacatattgag
cagatgcgtttgtccgccaccaaagcgatgctggagcggcgtgatgtggttgtggtggcg
tctgtttccgcgatttatggtctgggcgatcctgatttatatctcaagatgatgctccat
ctcacggtcggtatgattatcgatcagcgcgcgattctgcgccgactggcggagctgcaa
tacgctcgtaatgatcaagcattccagcgtggtactttccgcgttcgtggcgaggtgata
gatatcttcccggcagaatcggatgacattgcacttcgcgtggaactgtttgacgaggaa
gtggaacgattgtcgttatttgacccgctgaccgggcagattgtttccactattccacgt
tttaccatctacccgaaaacgcactacgtcacaccgcgcgagcgcatcgtacaggcgatg
gaggagatcaaagaagagctggccgccagacgcaaagtgctgttggaaaacaacaaactg
ctggaagagcagcggctgacccagcgtacccagtttgatctggagatgatgaacgagctg
ggctactgttcggggattgaaaactactcgcgcttcctctccggtcgtggaccgggtgag
ccaccgccgacgctgtttgattacctgcctgccgatgggctgctggtcgtcgatgaatct
cacgtcaccattccacaaattggcggcatgtatcgcggtgaccgggcgcgtaaagagaca
ctggtggagtacggcttccgcctgccatcagcgctggataaccgtccgcttaagtttgaa
gagttcgaagcattagcgccgcaaaccatctatgtttcggcgacgccgggtaattacgag
ctggaaaaatccggcggcgatgtggtggatcaggtggtgcgtccaaccggattgcttgac
ccgattatcgaagtgcggccggtggcgacacaggttgatgatcttctttcggagattcgt
cagcgagcggcaattaacgaacgcgtactggtcaccacactgaccaagcggatggcggaa
gatcttaccgaatatctcgaagaacatggcgagcgcgtgcgttatcttcactcagatatc
gacaccgtcgaacgtatggagattatccgcgacttgcgtctgggtgagttcgacgtgctg
gtagggatcaacttactgcgcgaaggtctggatatgccggaagtgtcgctggtggcgatc
ctcgacgctgacaaagaaggcttcctgcgttccgaacgttcgttgatccagaccattggt
cgtgcggcacgtaacgttaacggtaaagcgattctctacggcgataagatcaccccatca
atggcgaaagcgattggcgaaaccgaacgtcgccgtgagaaacagcagaagtacaacgag
gaacacggaattacgccgcaaggcttgaacaagaaagtggtcgatatcctggcgctgggg
cagaacattgccaaaaccaaagcgaagggcagaggaaaatcgcgcccgattgttgagccg
gataatgtgccgatggatatgtcgcctaaagcgttgcagcagaaaatccatgagctggaa
gggttgatgatgcaacacgcgcagaatctggagttcgaagaagcggcgcaaattcgtgac
cagttgcatcagctgcgtgagctgtttatcgcggcatcgtaa

DBGET integrated database retrieval system