KEGG   Escherichia coli ATCC 8739: EcolC_3249Help
Entry
EcolC_3249        CDS       T00697                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl00730  Thiamine metabolism
ecl00790  Folate biosynthesis
ecl01100  Metabolic pathways
ecl02020  Two-component system
Module
ecl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    EcolC_3249
   00790 Folate biosynthesis
    EcolC_3249
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EcolC_3249
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecl04147]
    EcolC_3249
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecl00537]
    EcolC_3249
Enzymes [BR:ecl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     EcolC_3249
Exosome [BR:ecl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EcolC_3249
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecl00537]
 Enzymes
  EcolC_3249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Phosphodiest Sulfatase
Motif
Other DBs
NCBI-ProteinID: ACA78871
LinkDB All DBs
Structure
PDB: 

Position
complement(3556481..3557896)
Genome map
AA seq 471 aa AA seqDB search
MKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGDITAPGGARRLTGDQTAALRDSLS
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPFTGQYTHYALNKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKASGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVNDAASLNAVTEVNQQKPLLGLFADGNMPVRWLGPKATYHGN
IDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALEFAKKEGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcactattgcactggcactcttaccgttactgtttacccctgtgacaaaa
gcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgatattactgca
cccggcggtgctcgccgcttaacgggtgatcagaccgccgctctgcgtgattctcttagc
gataaacctgcaaaaaatattattttgctgattggcgatgggatgggggattcggaaatt
actgccgcacgtaattatgccgaaggtgcgggcggcttttttaaaggtatcgatgcctta
ccgtttaccgggcaatacactcactatgcgctgaataaaaaaaccggcaaaccggactac
gtcaccgactcggctgcatcagcaaccgcctggtcaaccggtgtcaaaacctataacggc
gcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatggcaaaagcc
tcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacgcccgctgcg
ctggtggcgcatgtgacctcgcgcaaatgctacggtccgagcgcgaccagtgaaaaatgt
ccgggtaacgctctggaaaaaggcggaaaaggatcgattaccgaacagctgcttaacgct
cgtgccgacgttacgcttggcggtggcgcaaaaacctttgctgaaacggcaaccgccggt
gaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcagttggtgaac
gatgccgcctcgctaaatgcggtgacggaagtgaatcagcaaaaacccctgcttggcctg
tttgctgacggcaatatgccagtgcgctggctaggaccgaaagcaacgtaccatggcaat
atcgataagcccgcagtcacctgtacgcctaatccgcaacgtaatgacagtgtaccaacc
ctggcgcagatgaccgacaaagccattgaattgttgagtaaaaatgagaaaggctttttc
ctgcaagttgaaggtgcgtcaatcgataaacaggatcatgctgcgaatccttgtgggcaa
attggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattcgctaaaaag
gagggtaacacgctggtcatagtcaccgctgatcacgcccacgccagccagattgttgcg
ccggataccaaagctccgggcctcacccaggcgctaaataccaaagatggcgcagtgatg
gtgatgagttacgggaactctgaagaggattcacaagaacatacaggcagtcagttgcgt
attgcggcgtatggcccgcatgccgccaatgttgttggactgaccgaccagaccgatctc
ttctacaccatgaaagccgccctggggctgaaataa

DBGET integrated database retrieval system