KEGG   Escherichia coli ATCC 8739: EcolC_4194
Entry
EcolC_4194        CDS       T00697                                 

Definition
(GenBank) DNA helicase II
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl03420  Nucleotide excision repair
ecl03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    EcolC_4194
   03430 Mismatch repair
    EcolC_4194
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ecl03400]
    EcolC_4194
Enzymes [BR:ecl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EcolC_4194
DNA repair and recombination proteins [BR:ecl03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     EcolC_4194
   MMR (mismatch excision repair)
    Other MMR factors
     EcolC_4194
SSDB
Motif
Pfam: UvrD_C UvrD-helicase AAA_19 AAA_30 UvrD_C_2 Exonuc_V_gamma
Other DBs
NCBI-ProteinID: ACA79791
LinkDB
Structure
PDB: 
3LFU 2IS6 2IS4 2IS1 2IS2

Position
complement(4631396..4633558)
AA seq 720 aa
MDVSYLLDSLNDKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAWLMSVENCSPYSIMAV
TFTNKAAAEMRHRIGQLMGTSQGGMWVGTFHGLAHRLLRAHHMDANLPQDFQILDSEDQL
RLLKRLIKAMNLDEKQWPPRQAMWYINSQKDEGLRPHHIQSYGNPVEQTWQKVYQAYQEA
CDRAGLVDFAELLLRAHELWLNKPHILQHYRERFTNILVDEFQDTNNIQYAWIRLLAGDT
GKVMIVGDDDQSIYGWRGAQVENIQRFLNDFPGAETIRLEQNYRSTSNILSAANALIENN
NGRLGKKLWTDGADGEPISLYCAFNELDEARFVVNRIKTWQDNGGALAECAILYRSNAQS
RVLEEALLQASMPYRIYGGMRFFERQEIKDALSYLRLIANRNDDAAFERVVNTPTRGIGD
RTLDVVRQTSRDRQLTLWQACRELLQEKALAGRAASALQRFMELIDALAQETADMPLHVQ
TDRVIKDSGLRTMYEQEKGEKGQTRIENLEELVTATRQFSYNEEDEDLMPLQAFLSHAAL
EAGEGQADTWQDAVQLMTMHSAKGLEFPQVFIVGMEEGMFPSQMSLDEGGRLEEERRLAY
VGVTRAMQKLTLTYAETRRLYGKEVYHRPSRFIGELPEECVEEVRLRATVSRPVSHQRMG
TPMVENDSGYKLGQRVRHAKFGEGTIVNMEGSGEHSRLQVAFQGQGIKWLVAAYARLESV
NT seq 2163 nt   +upstreamnt  +downstreamnt
atggacgtttcttacctgctcgacagccttaatgacaaacagcgcgaagcggtggccgcg
ccacgcagcaaccttctggtgctggcgggcgcgggcagtggtaagacgcgcgtactggtg
catcgtatcgcctggttgatgagcgtggaaaactgctcgccatactcgattatggcggtg
acgtttaccaacaaagcggcggcggagatgcgtcatcgtatcgggcaactgatgggcacg
agccagggcggtatgtgggtcggcaccttccacgggctggcgcaccgtttgctgcgtgcg
caccatatggacgccaatctgccgcaggatttccagatcctcgatagcgaagaccagcta
cgcctgcttaagcgtctgatcaaagccatgaacctcgacgagaagcagtggccgccgcgg
caggcaatgtggtacatcaacagccagaaagatgaaggcctgcgtccgcatcatattcaa
agctacggtaatccggtggagcagacctggcagaaggtgtatcaggcgtatcaggaagcg
tgtgaccgcgcgggcctggtggacttcgccgagctgctgctgcgcgctcacgagttgtgg
cttaacaagccgcatatcctgcaacactaccgcgaacgttttaccaatatcctggtggac
gaattccaggataccaacaacattcagtacgcgtggatccgcctgctggcgggcgacacc
ggcaaagtgatgatcgtcggtgatgacgaccagtcaatctacggctggcgcggggcgcag
gtggagaatattcagcgtttccttaatgatttccccggtgccgaaactattcgtctggag
caaaactaccgctctaccagcaatattctgagcgccgctaacgccctgattgaaaacaat
aacgggcgtctgggtaaaaaactgtggaccgatggcgcggacggtgagcctatttccctc
tattgcgcttttaacgaactcgatgaagcgcgttttgtggttaaccgcatcaaaacctgg
caggacaacggcggggcgcttgccgagtgcgccattctctaccgcagtaacgcccagtcg
cgtgtgctggaagaagcactgttgcaggcgagtatgccgtaccgtatttacggcgggatg
cgcttcttcgaacgccaggaaatcaaagatgcgctctcgtatctgcgcctgattgccaac
cgtaacgacgacgcggcctttgagcgtgtggtgaatacgccaacgcggggtattggtgac
cggacgctggacgtggtacgtcagacatcgcgcgatcgccagttaacactctggcaggca
tgtcgtgaactgttgcaggaaaaagccctcgccggacgtgctgccagcgccttacagcgg
tttatggaactgatcgacgccttagcgcaggaaactgccgatatgccgctgcatgtacag
actgaccgggtaattaaagactccggcctgcgtaccatgtacgagcaggagaagggcgaa
aaaggtcagacgcgtatcgaaaacttagaggaactggtgacggcaacgcgccagttcagc
tacaacgaagaagacgaagatttaatgccgctgcaggcgttcctatcccatgcggcgctg
gaagcaggcgaagggcaggcggatacctggcaggatgcggtacaactgatgaccatgcac
tcggcgaaaggtctggagttcccgcaggtgtttatcgtcggtatggaagagggcatgttc
ccaagccagatgtcgctggatgaaggcgggcgtctggaagaagaacgccgtctggcctac
gttggcgtaacccgcgcgatgcagaaactgacgctgacctacgcggaaactcgccgtctg
tatggcaaagaggtttaccatcgcccgtcgcgctttattggcgagctgccggaagagtgt
gtggaagaggtgcgcctgcgcgccacggtaagccgcccggtcagccatcagcggatgggt
acgccgatggtcgagaacgacagcggctacaagctcggccagcgtgtacgccacgctaag
tttggtgaaggcaccatcgtcaatatggaaggcagcggtgaacatagccgtttgcaggtg
gcattccagggccagggaatcaaatggctggtggcagcttacgcccggctggagtcggtg
taa

DBGET integrated database retrieval system