KEGG   Enterobacter hormaechei subsp. hoffmannii ECNIH3: ECNIH3_00900Help
Entry
ECNIH3_00900      CDS       T03350                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
ecla  Enterobacter hormaechei subsp. hoffmannii ECNIH3
Pathway
ecla00260  Glycine, serine and threonine metabolism
ecla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECNIH3_00900 (tdh)
Enzymes [BR:ecla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     ECNIH3_00900 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 HI0933_like FAD_binding_2 Pyr_redox_3 FAD_oxidored Methyltransf_16 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AIN20917
LinkDB All DBs
Position
184328..185356
Genome map
AA seq 342 aa AA seqDB search
MKALSKLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHIYNWDQWSQKTIPVPMV
VGHEYVGEVVGIGQEVKGFNIGDRVSGEGHITCGHCRNCRGGRTHLCRNTVGVGVNRPGC
FAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDLVGEDVLVSGAGPIGIMAA
AVAKHVGARNVVITDVNEYRLSLARKMGVTRAVDVSKESLTDVMEELGMTEGFDVGLEMS
GAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWNKVIFKGLFIKGIYGREMFETWYKMAA
LIQSGLDLSPIITHRFSIDEFQQGFDAMRSGQSGKVILSWDK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttatccaaactgaaagcggaagaagggatttggatgaccgacgtgccggag
ccggaagtcggtcataacgatctgctgatcaaaattcgtaaaaccgccatctgcggtact
gacgttcacatctacaactgggaccagtggtcgcaaaaaaccattcccgtgccaatggtt
gtcggccacgaatatgtcggcgaagtggtcggcattggccaggaagtgaaaggcttcaac
attggcgaccgcgtctccggtgaaggccacattacctgcggtcactgccgcaactgtcgc
ggcggacgtacgcacctgtgccgcaacaccgtcggcgtgggcgtgaaccgtccgggatgc
ttcgcggaatacctggtgatcccggcgtttaacgcgttcaaaatcccggacaatatctct
gacgatctggcctccatcttcgacccgttcggcaacgcggtacacacggcgctctccttc
gacctggtgggtgaagacgtgctggtctccggcgcgggcccaatcggcattatggcggca
gccgtggcgaagcatgtgggtgcgcgcaacgtggtgatcaccgacgtgaacgaataccgc
ctgtcgctggcgcgcaaaatgggcgtcacccgcgcggtggatgtctcgaaagagagcctg
acagacgtgatggaagagctgggcatgaccgaaggctttgacgtgggtctggagatgtcc
ggcgcgccaccggcgttccgcaccatgctcgacaccatgaaccacggtggccgaatcgcg
atgctgggtattccgccgtcagatatgtccatcgactggaacaaagtcatcttcaagggg
ctgttcattaagggcatttatggccgcgagatgttcgaaacctggtacaagatggctgcg
ctgatccagtccggtctggatctgtccccgattatcactcaccgtttctccatcgatgag
ttccagcagggcttcgacgcaatgcgttccggccagtcagggaaagtgatcctgagctgg
gataagtaa

DBGET integrated database retrieval system