KEGG   Enterobacter hormaechei subsp. hoffmannii ECNIH3: ECNIH3_04665Help
Entry
ECNIH3_04665      CDS       T03350                                 

Definition
(GenBank) beta-lactam-binding protein
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
ecla  Enterobacter hormaechei subsp. hoffmannii ECNIH3
Brite
KEGG Orthology (KO) [BR:ecla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecla01002]
    ECNIH3_04665
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ecla01011]
    ECNIH3_04665
Enzymes [BR:ecla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ECNIH3_04665
   3.4.21  Serine endopeptidases
    3.4.21.-  
     ECNIH3_04665
Peptidases and inhibitors [BR:ecla01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   ECNIH3_04665
Peptidoglycan biosynthesis and degradation proteins [BR:ecla01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ECNIH3_04665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AIN21618
LinkDB All DBs
Position
complement(987033..988193)
Genome map
AA seq 386 aa AA seqDB search
MKRCLLSFAALCAVSLSTAQAAQPLTAPVLASDIADRYANLIYYGSGATGMALVVIDGNQ
RVFRSFGETRPGNNVRPQLDSVIRVASITKLMTSEMLVKLLDQGVVKLDDPLSKYAPPGA
RVPTYQGTPIRLVNLATHTSALPREQPGGAAHRPVFVWPTREQRWNYLSTATLKSAPGSQ
AGYSNLAFDLLADALATASGKPYPQLFEEQITRPLGMKDTTYTPSPDQCKRLMVAEKGAS
PCNNTLAAIGSGGVYSTPGDMMRWMQQFLSSDFYARSNQADRMQTLIYQRAQLRRVIGMD
VPGKADALGMGWVYMAPKDGRPGIIQKTGGGGGFITYMAMIPQSNVGAFVVVTRSPNTRF
VNMSDGVNNLVAELSANKAQVLTAAN
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgttgtctgctctctttcgccgcgctgtgtgcggtgagcctgtccaccgcccag
gcagcacagcctctgacggcaccggttctggcctctgacattgccgatcgctatgcgaac
cttatttattacggcagtggtgcgacgggaatggcgctggtcgtgatcgacggtaaccag
cgggtgtttcgcagcttcggtgaaacacgaccgggaaataacgttcgcccgcagctggat
tccgttatccgtgtcgcgtcgataactaagttgatgaccagcgaaatgctggtgaaattg
ctcgatcagggcgtggtaaaactcgacgatccactcagcaaatatgcgccacccggcgct
cgcgttccgacatatcagggaacgccgatcaggctggtgaacctggcgacccataccagc
gccctgccgcgagaacagcccggtggcgctgcgcatcgccctgtctttgtctggccaact
cgcgaacaacgctggaactacctgagcaccgcaacgctgaaatcggctccgggttctcag
gctggctattctaacctggcgtttgatctgctggccgacgcgttagcaacggcatcaggt
aagccttaccctcagctgtttgaagagcaaatcacgcgtccgctcgggatgaaagatact
acttacaccccctccccggaccagtgcaagcgtctgatggtggcggaaaaaggggccagc
ccgtgtaataacacgctggcagccattggcagcggtggggtttactctacgcctggcgac
atgatgcgctggatgcaacagttcctctcatcggatttttacgcgcgcagtaatcaggcc
gaccgaatgcagacgctcatctaccagcgtgctcagttacgtcgcgtcattggtatggat
gttcccggtaaagccgatgccctcggcatgggctgggtatatatggcgccaaaagatggt
cgcccgggtattattcaaaaaaccggtgggggtggcggattcatcacctacatggcgatg
attccgcaatcaaacgtgggcgcttttgtggtggtcacccggtcaccgaacacccgcttc
gtgaatatgagtgatggcgtaaataaccttgtagccgagctgagcgccaataaagcgcag
gtacttacggccgctaactga

DBGET integrated database retrieval system