KEGG   Enterobacter cloacae ECNIH3: ECNIH3_09455Help
Entry
ECNIH3_09455      CDS       T03350                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ecla  Enterobacter cloacae ECNIH3
Pathway
ecla00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ecla00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ECNIH3_09455
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecla02000]
    ECNIH3_09455
Enzymes [BR:ecla01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ECNIH3_09455
Transporters [BR:ecla02000]
 Other Transporters
  Pores ion channels [TC:1]
   ECNIH3_09455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_2 GST_C_3 GST_N_2 GST_N GST_N_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AIN22525
LinkDB All DBs
Position
complement(1985061..1985666)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLRESGKDFTLDGVDLMKKRLENGDDFFAINPKGQVPALLLDDG
TLLTEGVAIMQYLADNVPDRQLLAPTGSISRYKTLEWLNYIATELHKGFTPLFRPDTPEE
YKPTVRALLEKKMQYINESLKDDQWICGARFTIADAYLFTVLRWARTVKLNLEGLDHIAS
YMERVAARPAVAAALKAEGLN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctataaaccgggcgcctgctctcttgcttcgcatatcacccttcgcgag
agcggtaaggatttcacgctggacggcgttgacctgatgaaaaagcgcctggaaaacggg
gatgacttttttgcgattaacccaaaagggcaggttccggccctgctgctggatgatggt
acgctgctgaccgaaggcgtggcgattatgcagtacctggccgacaacgtgcctgatcgt
cagctgctggcaccaacaggcagtatctctcgctataaaacccttgagtggcttaactac
atcgcgaccgagctgcacaaaggctttacgccgctgttccgcccggatactccggaagag
tacaaaccgaccgtacgtgcgttacttgagaaaaagatgcagtacattaatgaatcactg
aaagacgatcagtggatctgcggtgcgcgtttcaccattgctgatgcgtatctgtttacc
gttctgcgctgggcgcgcacggtgaagctgaacctggaaggattagatcatattgcgtcg
tatatggaacgcgtagcggcacgccctgcggttgcagcggcgctgaaggcagaagggttg
aattaa

DBGET integrated database retrieval system