KEGG   Enterobacter hormaechei subsp. hoffmannii ECNIH3: ECNIH3_13585Help
Entry
ECNIH3_13585      CDS       T03350                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ecla  Enterobacter hormaechei subsp. hoffmannii ECNIH3
Pathway
ecla00500  Starch and sucrose metabolism
ecla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECNIH3_13585
Enzymes [BR:ecla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ECNIH3_13585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939
Motif
Other DBs
NCBI-ProteinID: AIN23306
LinkDB All DBs
Position
2870310..2871797
Genome map
AA seq 495 aa AA seqDB search
MRNPTLLQCFHWYYPTGGELWREVTALAPNLNEIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSVATKYGDKAQLLEAINALKSNQIAVLLDVVVNHKMGADEKEPVRVQRV
DAQDRTQISDEIIECEAWTRYTFPVRAGQYSQFIWDYKCFSGIDHIENPSEDGIFKIVND
YTGEGWNDQVDDEMGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTHCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPQPLFIVAEYWSHEVDKLQQYINQVDGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYPDLFGASYDDTGGDGETYHIDMPVIEQLHELILARQRFAHGVQTLFFDHPNCI
AFSRSGTEEQPGCVVVLSNGDNGEKTICLGENYGNKTWRDFLGNREETVTTAADGEGTFF
CNGGSVSVWVIEDAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacccaacacttttacaatgttttcactggtactaccccaccggcggtgaattg
tggcgagaagtcacggcattagcccccaacctgaacgaaatcggcatcaatatggtctgg
ttacccccggcctacaaaggcgcatccggcggctattccgtcgggtatgactcttatgac
cttttcgacctcggtgagtttgaccagaaaggcagcgtcgccaccaaatacggcgataaa
gcccaactgctggaggccatcaacgccttaaaaagcaaccagattgcggtgcttctggac
gtggtggtcaaccataaaatgggggccgatgaaaaggaacccgtccgcgtgcaacgcgtg
gatgctcaggatcgcacccaaatcagcgatgagatcatcgaatgtgaagcctggacgcgc
tacaccttccccgttcgggccgggcagtattcgcagttcatctgggattacaaatgcttt
agcggtatcgaccacattgaaaatcccagtgaggacggtatcttcaaaatcgttaacgac
tacaccggcgaaggctggaacgatcaggtcgacgacgagatgggcaatttcgattacctg
atgggtgaaaatattgattttcgcaaccacgcggtgacggaggagatcaaatactgggcg
cgctgggtgatggagcaaacccactgcgacggcttccgcctggacgcggtaaaacacatt
ccggcctggttctataaagagtggattgaacatgtccaggaggtggccccgcagccgcta
tttattgtggcggaatactggtctcacgaagtggataaattgcagcaatacatcaatcag
gtggacggcaaaaccatgttgtttgacgcgccgctgcaaatgaaatttcacgaagcgtca
cgccagggacgcgactacgatatgagccagattttcaccggtacgctggtggaagccgat
ccgttccatgccgtaacgctggtggccaaccatgacacccagcccttgcaggcgctggaa
gccccggttgaagcctggttcaaaccgctggcctacgcgctcatcctgctgcgtgaaaac
ggcgtgccgagcgtgttctacccggatctttttggcgccagctatgacgacactggcggg
gatggtgagacgtatcacattgatatgccggtgattgaacagctccacgagctgatcctc
gcccggcagcgttttgcccacggcgtgcaaaccctctttttcgatcatccaaactgcatt
gcgtttagccgcagcgggacagaggagcaaccgggctgtgtggtggtgctgtcgaatggt
gataacggtgagaagacgatctgcctcggcgagaattacggcaataagacctggcgggat
tttttaggcaaccgcgaggaaaccgtgaccacggcggctgatggcgaagggacgttcttc
tgtaacgggggaagcgtcagcgtctgggtgattgaggacgcgctgtag

DBGET integrated database retrieval system