KEGG   Enterobacter hormaechei subsp. hoffmannii ECNIH3: ECNIH3_15105Help
Entry
ECNIH3_15105      CDS       T03350                                 

Definition
(GenBank) carbohydrate degradation protein
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
ecla  Enterobacter hormaechei subsp. hoffmannii ECNIH3
Pathway
ecla00030  Pentose phosphate pathway
ecla01100  Metabolic pathways
ecla01110  Biosynthesis of secondary metabolites
ecla01120  Microbial metabolism in diverse environments
ecla01130  Biosynthesis of antibiotics
ecla01200  Carbon metabolism
ecla01230  Biosynthesis of amino acids
Module
ecla_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ecla_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ecla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECNIH3_15105
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    ECNIH3_15105
Enzymes [BR:ecla01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     ECNIH3_15105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N DXP_synthase_N E1_dh XFP_N TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AIN23590
LinkDB All DBs
Position
complement(3211081..3211911)
Genome map
AA seq 276 aa AA seqDB search
MNENEITELARQIRLETLKSLTQLGFGHYGGSMSVVETLAVLYGAVMKIDPADPDWPERD
YFVLSKGHAGPALYSTLAIKGYFPIEELSTLNQNGTRLPSHPDRLKTRGVDATTGSLGQG
ISIAGGMALSHKLAGRPNRVFCIVGDGELNEGQCWEAFQFIAHHRLNNLTVFVDWNKQQL
DGELDEIISAFDLEGKFRAFGFDVVTVKGDDIPALLEVTAPIPATDARPRVVILDSIKGQ
GVPYLEQLSNSHHLRLTEESKAALNETIRQLEASHD
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagaatgaaataaccgaactggcgcgtcagatccgccttgagacgctgaaatcc
ctgacgcagctgggttttggtcactacggcggcagcatgtcagtcgttgaaacactggcc
gttctgtacggcgcggtaatgaaaattgacccggccgatccggactggccagagcgcgat
tactttgtgctgtcgaagggccatgcgggcccggcgctgtacagcacgctggcgattaag
ggctacttcccgattgaagagctgagcacgctaaaccagaacggaacgcgtctgccaagc
cacccggatcgcctgaaaacacgcggcgtggatgccaccaccggatcgctggggcagggg
atctccattgcaggcggcatggcgctgtcgcacaagctggcaggaaggccaaaccgggtg
ttttgcatcgttggcgacggggagctgaacgaagggcagtgctgggaagccttccagttt
attgctcaccatcgactgaacaatctgacggtgttcgtggactggaacaaacagcagctc
gacggcgagctggacgaaatcatcagcgccttcgatctggaaggcaaattccgcgccttt
ggttttgacgtggtgacggtgaaaggggacgacattccggcgctgctggaggtgaccgcg
ccgatccctgcgaccgatgcgcgtccgcgggtggtgatcctcgacagcatcaaagggcag
ggggtgccttacctggaacagctcagcaactcgcatcacctgcgattaactgaggaaagc
aaagcggcgctcaacgagacgattcgccaactggaggcttcacatgattaa

DBGET integrated database retrieval system