KEGG   Enterobacter hormaechei subsp. hoffmannii ECNIH3: ECNIH3_15250Help
Entry
ECNIH3_15250      CDS       T03350                                 

Definition
(GenBank) 3-oxoacyl-ACP synthase
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
ecla  Enterobacter hormaechei subsp. hoffmannii ECNIH3
Pathway
ecla00061  Fatty acid biosynthesis
ecla00780  Biotin metabolism
ecla01100  Metabolic pathways
ecla01212  Fatty acid metabolism
Module
ecla_M00083  Fatty acid biosynthesis, elongation
ecla_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ecla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ECNIH3_15250
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ECNIH3_15250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecla01004]
    ECNIH3_15250
Enzymes [BR:ecla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     ECNIH3_15250
Lipid biosynthesis proteins [BR:ecla01004]
 Fatty acid synthase
  Component type
   ECNIH3_15250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: AIN23619
LinkDB All DBs
Position
complement(3236586..3237803)
Genome map
AA seq 405 aa AA seqDB search
MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSEEFKDSGMRSHVWGNVKLDTTGLI
DRKVVRFMNDASIYAYLSMQEAIKDSGLSEDAYQNNPRVGLIAGSGGSSKAQVFGADAMR
SPRGLKAVGPYVVTKAMGSAVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGK
QDIVFAGGGEELGWEMACEFDAMGALSTKYNETPDKASRTYDAHRDGFVIAGGGGMVVVE
ELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGTS
TPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLENGFIAPSINI
DEMDEQAAGLNIVTETTERELTTVMSNSFGFGGTNATLVMRKLKA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgcagtgattactggcctgggcatcgtttccagcatcggtaataaccagcag
gaagtcctggcatctctgcgtgaaggacgctccgggatcactttctctgaagagtttaaa
gattctggaatgcgtagccacgtatggggtaacgttaaactggataccaccggtttaatt
gaccgtaaagtggttcgtttcatgaacgatgcctctatctacgcctatctttccatgcag
gaagcgatcaaggattctggtctgagcgaagacgcttaccagaacaacccacgcgtgggc
ctgattgcaggctccggcggttcctctaaagctcaggtgttcggtgctgacgccatgcgc
agcccgcgcggcctgaaagcggttggtccatatgttgtgaccaaagccatgggttcagcg
gtttccgcgtgcctggcaacgccgttcaaaatccacggtgtgaactactccatcagctcc
gcatgtgcgacctccgcacactgtatcggtaatgcggttgagcagatccagctgggcaaa
caggacatcgtatttgctggcggcggcgaagagctgggctgggaaatggcctgtgagttc
gacgcgatgggcgcactgtccaccaaatacaacgaaacgccagacaaagcatcccgtacc
tatgatgcacaccgcgacggttttgttatcgctggcggcggcggtatggttgtggttgaa
gagctggaacacgcgctggcgcgtggcgcgcacatctacgctgagatcgtgggctacggc
gcaacgtctgacggcgctgacatggttgctccatccggcgaaggcgcggtgcgctgcatg
aagatggcgatgcacggcgttgataccccaatcgactacctgaactctcacggcacctca
acgccggtaggtgacgtgaaagagctgggtgcgatccgtgaagtgttcggcgacaacagt
ccggctatctctgcaaccaaagccatgaccggtcactctctgggcgcggcgggcgtgcag
gaagcgatctactctctgctgatgctggaaaacggctttatcgcgccaagcatcaacatc
gacgagatggacgagcaggcggcaggcctgaacatcgtgaccgaaaccaccgaacgtgag
ctgacgaccgttatgtccaacagcttcggtttcggcggcaccaacgccacgctggtgatg
cgtaagctgaaagcgtaa

DBGET integrated database retrieval system