KEGG   Enterobacter hormaechei subsp. hoffmannii ECNIH3: ECNIH3_15300Help
Entry
ECNIH3_15300      CDS       T03350                                 

Gene name
fadJ
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ecla  Enterobacter hormaechei subsp. hoffmannii ECNIH3
Pathway
ecla00071  Fatty acid degradation
ecla00280  Valine, leucine and isoleucine degradation
ecla00281  Geraniol degradation
ecla00310  Lysine degradation
ecla00362  Benzoate degradation
ecla00380  Tryptophan metabolism
ecla00410  beta-Alanine metabolism
ecla00640  Propanoate metabolism
ecla00650  Butanoate metabolism
ecla00903  Limonene and pinene degradation
ecla00930  Caprolactam degradation
ecla01100  Metabolic pathways
ecla01110  Biosynthesis of secondary metabolites
ecla01120  Microbial metabolism in diverse environments
ecla01130  Biosynthesis of antibiotics
ecla01200  Carbon metabolism
ecla01212  Fatty acid metabolism
Module
ecla_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ECNIH3_15300 (fadJ)
   00650 Butanoate metabolism
    ECNIH3_15300 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ECNIH3_15300 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECNIH3_15300 (fadJ)
   00310 Lysine degradation
    ECNIH3_15300 (fadJ)
   00380 Tryptophan metabolism
    ECNIH3_15300 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECNIH3_15300 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECNIH3_15300 (fadJ)
   00281 Geraniol degradation
    ECNIH3_15300 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECNIH3_15300 (fadJ)
   00930 Caprolactam degradation
    ECNIH3_15300 (fadJ)
Enzymes [BR:ecla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ECNIH3_15300 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECNIH3_15300 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ECNIH3_15300 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DUF362
Motif
Other DBs
NCBI-ProteinID: AIN23629
LinkDB All DBs
Position
complement(3246012..3248159)
Genome map
AA seq 715 aa AA seqDB search
METTSAFNLVVRLDNVAVITIDVPDEKMNTLKAEFGVQVRAMLRQIRENKAIRGLVFISA
KPDNFIAGADINMIARATSAQEAEDLARQGQQVMAEIHALSIPVVAAIHGACLGGGLELA
LACHSRICTDDAKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALEMILTGKQLRARQAL
KAGLVDEVVPHAILLEAAVERALKGRQAKRPLPVRERILAGPLGRTLLFNMVGKKTEQKT
RGNYPAATRILKVIETGLSQGSSSGYAAEAKAFGELAMTPQSQALRGIFFASTEVKKDPG
SEAEPAPLRAVGVLGGGLMGGGIAFVTASKGKLPVRIKDINPKGINHALQYSWQNLDRKV
KRRHIKASDRDKTLAMITGATDYSGFAHRDLVIEAVFEDLALKQQMVADVEQHCAPHTIF
ASNTSSLPIGDIAAKAMRPEQVIGLHYFSPVEKMPLVEVIPHATTSPQTIATVVKLAKKQ
GKTPVVVADKAGFYVNRILAPYINEAMRLLTEGEKIEHVDDALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGDRFAPPANFVSAILKDDRKGRKNERGFYLYAAKGRKSKKQVDPS
VYALIPVTGQGKLSAVQCAERCVMMMLNEAARCFGEQVIKSARDGDIGAVFGIGFPPFLG
GPFRYMDTLGAGEVVAILQRLASQYGPRFTPCDELLQMAERGQTFWPARETDCVN
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgacatctgcatttaaccttgttgttcgccttgataacgtggccgttatcacc
attgatgtgcccgacgaaaaaatgaataccctgaaggcggagttcggcgttcaggtgcgt
gcgatgctcagacagatccgcgaaaacaaagcgatacgtggcctggtatttatctcggca
aagccggataactttattgccggggccgatatcaacatgattgcccgggcgacaagcgct
caggaagcagaagatctggcgcgtcaggggcagcaggtgatggcggagatccatgcgctg
tcgatacccgttgtcgctgcgatccacggggcttgcctgggcggcgggcttgagctggcg
ctggcctgccacagtcgcatctgtaccgacgatgcgaaaaccgtactcggactgcctgaa
gtacagcttggattgctgcccggttcaggtggcacgcagcgcttgccgcggctggtgggc
gtcagtacggcgctggagatgattttaaccggtaaacagctgcgcgcccgtcaggcgtta
aaggcgggtctggttgatgaggtcgttccgcacgcaatcttgcttgaggctgccgttgag
cgggcgctgaaaggtcgtcaggcgaaacgccccctgccggtgcgtgagcgtatcctcgcc
gggccgctggggcgcacgctgctctttaatatggtgggtaaaaaaaccgagcaaaaaacc
agagggaactatccggcagcgacgcgcattctgaaggtgattgaaaccggtttatcgcag
ggcagcagcagcggttatgccgcggaagcgaaagcgtttggcgagctggcgatgacgccg
cagtcgcaggcgctgcgcggcattttctttgccagcacggaggttaaaaaagatccgggc
agtgaagctgaaccggctccgctgcgcgccgttggggttctgggtggtgggctgatgggc
ggcggcatcgcgtttgtcaccgccagcaaaggcaaattgcccgtacgtatcaaagatatc
aatcctaagggcatcaaccacgcgttgcagtacagctggcagaaccttgatcgcaaagtg
aaacgccgccatatcaaggccagcgatcgcgataaaaccctcgcgatgatcactggcgcc
accgactacagtgggtttgcacaccgcgatctggtgattgaagccgtgttcgaagatctg
gcccttaagcagcagatggtagcggacgttgaacagcattgcgcgccgcacaccattttc
gcgtcaaacacctcgtctttgccgatcggcgacatcgcggcgaaagccatgcgcccggag
caggtgatagggctgcactatttcagtcctgtcgaaaaaatgccgctggtggaggttatc
cctcatgccacaaccagcccgcaaactattgccaccgtggtgaagctggcgaaaaaacag
ggcaaaactcctgttgtggtcgcggacaaagccggcttctacgtcaaccgcattctggcg
ccgtatattaacgaagcgatgcggttgctgacggaaggggagaaaattgagcacgtcgat
gacgccctggtgaagtttggtttccccgtcggcccaatccaacttttggatgaggtagga
attgatacggggactaaaattatccctgtgctggaagcggcttatggcgatcgttttgcg
ccgcctgcaaactttgtttccgcaattttgaaggacgatcgcaaaggcagaaaaaatgaa
cgcggtttctatctttacgccgcgaaagggcgtaaaagcaagaaacaggtcgacccttcg
gtttatgcgcttattcctgtcacgggtcagggaaaactgtcggcggttcagtgtgctgag
cgctgcgtgatgatgatgctcaatgaagcggcgcgctgctttggtgagcaggtgatcaaa
agcgcgcgcgacggcgacatcggtgccgtgtttggtatcggttttccgccattccttggc
ggcccgttccggtatatggataccctcggggcgggtgaagtggttgcgatcctgcaacgt
ctggcctcgcaatacggtccacggtttacaccttgtgacgaattattgcagatggcggaa
cggggtcagacattctggcccgcaagggaaactgattgcgtaaactga

DBGET integrated database retrieval system