KEGG   Enterobacter hormaechei subsp. hoffmannii ECNIH3: ECNIH3_20670Help
Entry
ECNIH3_20670      CDS       T03350                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ecla  Enterobacter hormaechei subsp. hoffmannii ECNIH3
Pathway
ecla00250  Alanine, aspartate and glutamate metabolism
ecla00410  beta-Alanine metabolism
ecla00640  Propanoate metabolism
ecla00650  Butanoate metabolism
ecla01100  Metabolic pathways
ecla01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ECNIH3_20670
   00650 Butanoate metabolism
    ECNIH3_20670
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECNIH3_20670
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECNIH3_20670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecla01007]
    ECNIH3_20670
Enzymes [BR:ecla01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECNIH3_20670
Amino acid related enzymes [BR:ecla01007]
 Aminotransferase (transaminase)
  Class III
   ECNIH3_20670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIN24634
LinkDB All DBs
Position
complement(4343950..4345215)
Genome map
AA seq 421 aa AA seqDB search
MKNNELNDRRLQATPRGIGVMCNFYADKADNATVWDVEGNEYIDFAAGIAVLNTGHRHPK
VIAAIEKQLHAFTHTAYQIVPYEGYVALAERINQRVPIEGPAKTAFFSTGAEAVENAVKI
ARAYTRRPGLITFGGAFHGRTFMTMALTGKVAPYKLGFGPFPGSVYHAQFPNSLHGVSTA
EALKSLERIFKADIAPDQVAAIIIEPVQGEGGFNVAPADFMQALRALCDTHGILLIADEV
QTGFARTGKLFSMENHCVKPDLITMAKSLAGGMPLSAVSGRAEVMDAPAPGGLGGTYAGN
PLAIAAAHAVLDVIDEEDLCTRASHLGHHLVEVLNKAKDGCPWIADIRGQGSMVAVEFTD
PQTGQPSPEFTRQVQERALNEGLLLLSCGVYGNVIRFLYPLTIPEAQFRKALDIISASLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaataacgaactgaacgaccggcgtttacaggcgacgccgcgcggtatcggcgtc
atgtgtaacttctatgccgataaagccgacaacgccacggtgtgggatgtagaaggtaac
gagtatattgattttgccgccgggatcgccgtgctgaataccgggcatcgccatcctaaa
gttatcgccgccatcgaaaaacagcttcatgcctttacccataccgcttaccagatcgtc
ccctatgaaggttatgtggcgcttgccgagcgcatcaaccagcgcgtacccatagagggg
ccagccaaaaccgcctttttctcaaccggtgcagaagcggtcgaaaacgcggtgaaaatt
gctcgcgcgtacaccagacgtcccggccttatcaccttcggcggcgcgttccacggccgt
acctttatgaccatggcgctgaccggcaaagtggcgccctataagctcggcttcggcccg
ttccccggctcggtgtaccacgcgcaattccccaacagcctgcacggcgtcagtaccgcc
gaagcgttaaaaagcctggagcgcatcttcaaagccgatatcgcgcccgatcaggtggcg
gcaatcattattgaaccggttcagggcgagggcggattcaacgtcgcgcccgctgatttt
atgcaggcgctgcgtgccctgtgcgatacccacgggattttactgattgccgacgaagtg
caaaccggcttcgcccgtaccggcaagctattctccatggaaaaccactgcgtgaagccc
gatctgatcaccatggcgaaaagcctggcgggcggaatgccgctctctgccgtctctggc
cgggcagaggtgatggacgcgcccgctccgggcggactgggcggcacctacgcgggtaac
ccgctggcgattgcggcggcccatgcggtgctggacgtgattgacgaggaagatctctgc
acgcgcgcgtctcatctcggccatcatcttgtcgaggtgctgaataaagcgaaggatggc
tgtccctggatcgccgatatccgtgggcagggctcgatggtggcggtggaatttaccgat
ccgcaaaccggacagccgtcgccggaatttacccgtcaggttcaggagcgcgcgttgaac
gaagggctgctgcttttgagttgcggcgtctacggcaacgttatccgcttcctctacccg
ctcaccatccccgaagcgcagttccgtaaagcgctggatattatttccgcctcgctgaca
cgataa

DBGET integrated database retrieval system