KEGG   Enterobacter hormaechei subsp. hoffmannii ECNIH3: ECNIH3_21115Help
Entry
ECNIH3_21115      CDS       T03350                                 

Gene name
fadA
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
ecla  Enterobacter hormaechei subsp. hoffmannii ECNIH3
Pathway
ecla00071  Fatty acid degradation
ecla00280  Valine, leucine and isoleucine degradation
ecla00281  Geraniol degradation
ecla00362  Benzoate degradation
ecla00592  alpha-Linolenic acid metabolism
ecla01100  Metabolic pathways
ecla01110  Biosynthesis of secondary metabolites
ecla01120  Microbial metabolism in diverse environments
ecla01130  Biosynthesis of antibiotics
ecla01212  Fatty acid metabolism
Module
ecla_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ECNIH3_21115 (fadA)
   00592 alpha-Linolenic acid metabolism
    ECNIH3_21115 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECNIH3_21115 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    ECNIH3_21115 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECNIH3_21115 (fadA)
   00642 Ethylbenzene degradation
    ECNIH3_21115 (fadA)
Enzymes [BR:ecla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     ECNIH3_21115 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIN24715
LinkDB All DBs
Position
4441284..4442447
Genome map
AA seq 387 aa AA seqDB search
MEKVVIVDAIRTPMGRSKGGAFRNVRAEDLSAHLMRSLLARNPALDPAALDDIYWGCVQQ
TLEQGFNIARNASLLAEIPHSVPAVTVNRLCGSSMQALHDAARMIMTGDAQACLVGGVEH
MGHVPMSHGVDFHPGMSRNVAKAAGMMGLTAEMLSRLHGISREMQDAFAARSHARAWAAT
QSGAFKNEIIPTGGHDADGVLKQFSYDEVIRPETTVEALSTLRPAFDPVTGTVTAGTSSA
LSDGAAAMLVMSESRARELGLTPRARVRSMAVVGCDPSIMGYGPVPASKLALKKAGLSAS
DIDLFEMNEAFAAQILPCIKDLGLMDQIDEKINLNGGAIALGHPLGCSGARISTTLINLM
ERKDAQFGLATMCIGLGQGIATVFERV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggttgtcattgttgatgcaattcgcaccccgatgggccgttcaaaaggcggt
gcattccgtaacgtgcgtgcggaagatctctcggcgcacctgatgcgtagcctgctggcg
cgtaacccggcgctggaccctgctgcgctggacgatatttactggggctgcgtccagcag
acgctggagcagggtttcaacatcgcccgtaacgcgtctctgctggcggagatcccgcat
tcggttccggcggtcaccgtcaaccgtctttgcggttcgtcgatgcaggcgctgcacgac
gcggcacggatgatcatgaccggcgatgcgcaggcctgtctggtgggcggcgtggagcac
atgggccacgtgccgatgagccacggggtcgatttccatccgggcatgagccgcaacgtg
gcgaaagccgccggtatgatgggcctgaccgccgagatgctctcccgtctgcacggcatc
agccgtgaaatgcaggatgcctttgccgcgcgctcacatgcccgcgcctgggccgccacg
cagtctggtgcctttaagaatgagatcatcccaaccggcggtcacgacgcagacggcgta
ctgaagcagttcagctacgacgaagttatccgtcctgaaaccactgttgaagcgctttct
accctgcgtccggcgtttgatccggtcaccggcacggtaacggcgggcacctcgtctgcc
ctgtccgacggtgccgccgccatgttagtgatgagcgaaagccgcgcccgcgaattaggc
ctgacgccacgcgcccgcgtgcgttcgatggcagtcgtgggctgcgatccttccatcatg
ggttacggtccggtcccggcgtcaaaactggcgctgaaaaaagcggggctgagcgcaagt
gatatcgacctctttgagatgaacgaagcgttcgccgcgcagatcctgccgtgcattaaa
gatctggggctgatggatcagatcgacgagaagattaacctcaatggcggcgcgatagcc
ctcggtcacccgctgggctgctccggggcgcgtatcagcaccacgctgatcaacctgatg
gaacgcaaagatgcccagttcggactggcgacgatgtgtatcgggttgggtcaggggatc
gcgacggtgtttgagagagtgtaa

DBGET integrated database retrieval system