KEGG   Enterobacter hormaechei subsp. hoffmannii ECNIH3: ECNIH3_21650Help
Entry
ECNIH3_21650      CDS       T03350                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ecla  Enterobacter hormaechei subsp. hoffmannii ECNIH3
Brite
Enzymes [BR:ecla01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ECNIH3_21650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF4600
Motif
Other DBs
NCBI-ProteinID: AIN24814
LinkDB All DBs
Position
complement(4565966..4566586)
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKTGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKFQN
RRPDYIKAFWDVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttatacactgccatccctgccgtatgcctacgacgcactggaaccgcatttcgac
aagcagacgatggaaatccatcacactaaacatcaccagacctacgtgaataacgcgaat
gctgcgctggaaagcctgccagagttcgctaatctgcctgttgaagagctgatcaccaaa
ctggaccagctgccagcagacaagaaaaccgtgctgcgcaacaacgcgggcggtcacgct
aaccacagcctgttctggaaaggcctgaaaaccggcaccacccttcagggcgacctgaaa
gcggctatcgagcgtgacttcggttccgttgacaacttcaaagcggaattcgaaaaagcc
gctgcaacccgtttcggctctggctgggcgtggctggtcctgaaaggtgacaaactggcg
gtcgtttcaaccgcaaaccaggactccccgctgatgggtgaagctatctctggcgcatcc
ggcttcccaattctgggtctggacgtgtgggaacacgcttactacctgaagttccagaac
cgtcgccctgactacatcaaagccttctgggatgtagtgaactgggacgaagcagcagcg
cgtttcgccgctaaaaaataa

DBGET integrated database retrieval system