KEGG   Enterobacter hormaechei subsp. hoffmannii ECR091: ECR091_06370Help
Entry
ECR091_06370      CDS       T03378                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
eclc  Enterobacter hormaechei subsp. hoffmannii ECR091
Pathway
eclc00020  Citrate cycle (TCA cycle)
eclc00190  Oxidative phosphorylation
eclc00650  Butanoate metabolism
eclc01100  Metabolic pathways
eclc01110  Biosynthesis of secondary metabolites
eclc01120  Microbial metabolism in diverse environments
eclc01130  Biosynthesis of antibiotics
eclc01200  Carbon metabolism
Module
eclc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eclc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eclc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eclc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECR091_06370 (sdhA)
   00650 Butanoate metabolism
    ECR091_06370 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ECR091_06370 (sdhA)
Enzymes [BR:eclc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ECR091_06370 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     ECR091_06370 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: AIN27286
LinkDB All DBs
Position
1346437..1348203
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNS
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELDHMGLPFSRLENGTIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNADGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEQGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAVGLHLQ
ESIAEQGALRDATDDEIDASLERLNRWNGNRNGEDPVEIRKALQECMQHNFSVFREGDAM
AKGLEQLKAIRERLKNARLDDTSSEFNTQRVECLELDNLMETAFATAMSANFRTESRGAH
SRFDFPDRDDENWLCHSLYLPESETMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccagtcagagaatttgatgctgttgtgattggtgcgggtggcgcaggtatg
cgcgccgcactgcaaatttcccagagcggccagacctgtgcgctgctctctaaagtattc
ccgacccgttcccacactgtgtctgcgcagggcggtatcaccgttgcgctgggtaattcc
catgaagataactgggaatggcacatgtacgatacggtaaaaggttccgattacatcggt
gaccaggatgccatcgaatatatgtgtaaaactggcccggaagcgattctggagctggac
cacatgggtctgccgttctcccgtctggaaaatggcaccatctatcagcgtccgtttggc
ggccagtcgaaaaacttcggcggcgagcaggcggcacgtaccgcagcggcggctgaccgt
accggccacgcgctgctgcacacgctctatcagcagaacctaaaaaaccacaccaccatc
ttctccgagtggtatgcgctggatctggtgaaaaacgccgatggcgcggtggtgggttgt
accgcactgtgcattgaaaccggtgaagtggtctatttcaaagcgcgcgcaaccgtgctg
gccaccggcggcgcaggccgtatctatcagtccactaccaacgcccacatcaacaccggt
gacggcgttgggatggctatccgcgctggcgtgccggtgcaggacatggagatgtggcag
ttccacccaaccggtatcgccggtgcgggcgtgctggtgacagaaggctgccgtggtgaa
ggtggctatctgctgaacaaacatggcgagcgctttatggagcgttatgccccgaatgcg
aaagacctggcgggccgtgacgtggtggcgcgttccatcatgatcgaaatccgtgaaggc
cgcggctgcgacggcccttggggcccgcacgcgaagctgaaactcgaccatctgggtaaa
gaagtgctggaatcccgtctgccgggcattctggaactgtcccgcaccttcgcccacgtc
gacccggtgaaagagccgattccggttatcccaacctgtcactacatgatgggcggtatt
ccgaccaaagtgaccggtcaggcgctgaccgtgaacgagcagggcgaagacgtggtcatc
cctggtctgttcgcggtaggcgaaattgcctgcgtatccgtgcacggcgcaaaccgtctg
ggcggcaactccctgctggacctggtggtatttggccgtgcggtggggctgcatctccag
gaatctattgccgagcagggcgcgttgcgtgatgcgaccgacgacgaaattgatgcctct
cttgagcgcctcaaccgctggaacggcaaccgtaacggcgaagatccggtggaaatccgt
aaagcgctgcaagagtgtatgcagcacaacttctcggtattccgtgaaggtgacgcgatg
gccaaagggctggagcaactgaaagcgatccgcgagcgtctgaagaatgcccgtctggac
gatacctcgagcgagttcaacacccagcgcgttgagtgcctggagctggataacctgatg
gaaaccgcgttcgcgaccgcgatgtcggcaaacttccgtaccgaaagccgtggcgcccat
agccgcttcgatttcccggatcgtgatgacgaaaactggctgtgccattccctgtatctg
ccagagtcggaaaccatgacgcgtcgtagcgttaacatggaaccgaaactgcgtccggcg
ttcccgccgaagattcgtacttactaa

DBGET integrated database retrieval system