KEGG   Enterobacter hormaechei subsp. hoffmannii ECR091: ECR091_06375Help
Entry
ECR091_06375      CDS       T03378                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
eclc  Enterobacter hormaechei subsp. hoffmannii ECR091
Pathway
eclc00020  Citrate cycle (TCA cycle)
eclc00190  Oxidative phosphorylation
eclc00650  Butanoate metabolism
eclc01100  Metabolic pathways
eclc01110  Biosynthesis of secondary metabolites
eclc01120  Microbial metabolism in diverse environments
eclc01130  Biosynthesis of antibiotics
eclc01200  Carbon metabolism
Module
eclc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eclc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eclc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eclc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECR091_06375 (sdhB)
   00650 Butanoate metabolism
    ECR091_06375 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ECR091_06375 (sdhB)
Enzymes [BR:eclc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ECR091_06375 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     ECR091_06375 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AIN27287
LinkDB All DBs
Position
1348219..1348935
Genome map
AA seq 238 aa AA seqDB search
MKLEFSVYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEKDPTLSFRRSCREGVC
GSDGVNMNGKNGLACITPISALQRAGQKIVIRPLPGLPVVRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQSPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETENRLEGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgaattctcagtttatcgttataacccggatgtagacgatgctccgcgtatg
caggattacaccctcgaagcggaagaaggtcgtgacatgatgctgctggatgctttaatc
cagctgaaagaaaaagatcctacgctgtcgttccgccgctcctgccgtgaaggggtatgt
ggctctgacggtgtaaacatgaacggcaaaaacggtctggcctgtatcacgccaatttca
gcgctacagcgtgcaggccagaaaattgtcatccgtcctctgcctggcctgccggtcgtg
cgtgatttggtggtggacatggggcaattctatgcacaatatgagaagattaagccttac
ttattgaataatgggcaaaatccacccgctcgcgagcacttacagtcgcctgagcagcgt
gaaaaactcgatgggttgtacgagtgtattctctgtgcatgctgttcaacgtcatgcccg
tcattctggtggaacccggataaatttatcggccctgcgggtctgctggctgcctatcgc
ttcctgatcgacagccgcgataccgaaaccgagaatcgtctggaagggttaagtgacgct
ttcagcgtattccgctgccatagcatcatgaactgcgtcagtgtgtgtcctaaggggctg
aacccgacgcgcgccatcggccatattaagtcgatgttgttgcagcgcagtgcgtaa

DBGET integrated database retrieval system