KEGG   Enterobacter hormaechei subsp. hoffmannii ECR091: ECR091_11910Help
Entry
ECR091_11910      CDS       T03378                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
eclc  Enterobacter hormaechei subsp. hoffmannii ECR091
Pathway
eclc00240  Pyrimidine metabolism
eclc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    ECR091_11910
Enzymes [BR:eclc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ECR091_11910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: AIN28343
LinkDB All DBs
Position
complement(2532903..2533517)
Genome map
AA seq 204 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAR
LFNPETDLLEDIRAQHASKPIHCVLVDESQFLTREQVHALSEVVDELDIPVLCYGLRTDF
RGELFAGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQSGKPYADGEQVVIGGNERYVS
VCRKHYKEALAVGSLTALQGDNRK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactttatttctactattcggcaatgaatgcagggaaatcgacggcgttactg
caatcctcatacaattatcaggagcgggggatgcgtaccgttgtttataccgccgaaatc
gacgatcgctttggggcagggaaggtaagctcaagaatagggctctcgtcgcctgcaagg
ctgtttaaccctgaaacggacctgcttgaggacattcgtgcccagcatgcctctaagcct
atccattgcgtgctggtagatgaaagccagttcctgacccgtgagcaggtccatgcgctt
tcagaggtcgttgatgagctggatattcccgttctttgctatggattacgcactgacttt
cgcggtgagttatttgccggtagccagtatctgctcgcctggtcggataagctggttgag
ctgaaaactatctgcttttgtggccgcaaggcaagtatggttcttcgcctggaccagtcg
ggtaagccttatgctgatggcgagcaggttgtgatagggggcaatgaacgttatgtctcg
gtctgccgcaagcattataaagaggcgctggctgtaggctcgctgacggcgttacagggc
gacaatcgcaaataa

DBGET integrated database retrieval system