KEGG   Enterobacter cloacae ECR091: ECR091_20600Help
Entry
ECR091_20600      CDS       T03378                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
eclc  Enterobacter cloacae ECR091
Pathway
eclc00250  Alanine, aspartate and glutamate metabolism
eclc00410  beta-Alanine metabolism
eclc00640  Propanoate metabolism
eclc00650  Butanoate metabolism
eclc01100  Metabolic pathways
eclc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eclc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECR091_20600
   00650 Butanoate metabolism
    ECR091_20600
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECR091_20600
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECR091_20600
Enzymes [BR:eclc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECR091_20600
Amino acid related enzymes [BR:eclc01007]
 Aminotransferase (transaminase)
  Class III
   ECR091_20600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIN29974
LinkDB All DBs
Position
complement(4331927..4333192)
Genome map
AA seq 421 aa AA seqDB search
MKNNELNDRRLQATPRGIGVMCNFYADKADNATVWDVEGNEYIDFAAGIAVLNTGHRHPK
VIAAIEKQLHAFTHTAYQIVPYEGYVALAERINQRVPIEGPAKTAFFSTGAEAVENAVKI
ARAYTRRPGLITFGGAFHGRTFMTMALTGKVAPYKLGFGPFPGSVYHAQFPNSLHGVSTA
EALKSLERIFKADIAPDQVAAIIIEPVQGEGGFNVAPADFMQALRALCDTHGILLIADEV
QTGFARTGKLFSMENHCVKPDLITMAKSLAGGMPLSAVSGRAEVMDAPAPGGLGGTYAGN
PLAIAAAHAVLDVIDEEDLCTRASHLGHHLVEVLNKAKDGCPWIADIRGQGSMVAVEFTD
PQTGQPSPEFTRQVQERALNEGLLLLSCGVYGNVIRFLYPLTIPEAQFRKALDIISASLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaataacgaactgaacgaccggcgtttacaggcgacgccgcgcggtatcggcgtc
atgtgtaacttctatgccgataaagccgacaacgccacggtgtgggatgtagaaggtaac
gagtatattgattttgccgccgggatcgccgtgctgaataccgggcatcgccatcctaaa
gttatcgccgccatcgaaaaacagcttcatgcctttacccataccgcttaccagatcgtc
ccctatgaaggttatgtggcgcttgccgagcgcatcaaccagcgcgtacccatagagggg
ccagccaaaaccgcctttttctcaaccggtgcagaagcggtcgaaaacgcggtgaaaatt
gctcgcgcgtacaccagacgtcccggccttatcaccttcggcggcgcgttccacggccgt
acctttatgaccatggcgctgaccggcaaagtggcgccctataagctcggcttcggcccg
ttccccggctcggtgtaccacgcgcaattccccaacagcctgcacggcgtcagtaccgcc
gaagcgttaaaaagcctggagcgcatcttcaaagccgatatcgcgcccgatcaggtggcg
gcaatcattattgaaccggttcagggcgagggcggattcaacgtcgcgcccgctgatttt
atgcaggcgctgcgtgccctgtgcgatacccacgggattttactgattgccgacgaagtg
caaaccggcttcgcccgtaccggcaagctattctccatggaaaaccactgcgtgaagccc
gatctgatcaccatggcgaaaagcctggcgggcggaatgccgctctctgccgtctctggc
cgggcagaggtgatggacgcgcccgctccgggcggactgggcggcacctacgcgggtaac
ccgctggcgattgcggcggcccatgcggtgctggacgtgattgacgaggaagatctctgc
acgcgcgcgtctcatctcggccatcatcttgtcgaggtgctgaataaagcgaaggatggc
tgtccctggatcgccgatatccgtgggcagggctcgatggtggcggtggaatttaccgat
ccgcaaaccggacagccgtcgccggaatttacccgtcaggttcaggagcgcgcgttgaac
gaagggctgctgcttttgagttgcggcgtctacggcaacgttatccgcttcctctacccg
ctcaccatccccgaagcgcagttccgtaaagcgctggatattatttccgcctcgctgaca
cgataa

DBGET integrated database retrieval system