KEGG   Enterobacter hormaechei subsp. hoffmannii ECR091: ECR091_23105Help
Entry
ECR091_23105      CDS       T03378                                 

Definition
(GenBank) copper-binding protein
Organism
eclc  Enterobacter hormaechei subsp. hoffmannii ECR091
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AIN30439
LinkDB All DBs
Position
pENT-4bd:61830..62261
Genome map
AA seq 143 aa AA seqDB search
MKNIVLASLLGFGLISSAWATETVNIHERVNNAQAPAHQMQSAAAPVGIQGTTPRMAGMD
QHEQAIIAHETMTNGSADAHQKMVESHQRMMGSQTVSPTGPSKSLAAMNEHERAAVAHEF
MNNGQSGPHQAMAEAHRRMLSAG
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatcgtattagcatccttgctgggctttggtttaatttcttcggcctgggcc
actgaaaccgtgaatatccatgagcgggtcaacaatgcacaggctcctgctcaccagatg
cagtctgctgcggctcctgtcgggatccaggggactactcctcgtatggccggtatggac
cagcatgaacaggccattattgctcatgaaaccatgacgaacgggtcggcggatgcgcac
cagaaaatggttgaaagtcatcagaggatgatgggaagtcagaccgtttcccctaccggg
ccgtcgaagtcattagcggcaatgaatgagcatgaaagagctgcagttgcccatgaattt
atgaataacggtcagtctggcccacatcaggccatggccgaagcgcatcgtcgcatgctc
agtgcaggctga

DBGET integrated database retrieval system