KEGG   Enterobacter cloacae ECNIH2: ECNIH2_01545Help
Entry
ECNIH2_01545      CDS       T03471                                 

Gene name
cyaA
Definition
(GenBank) adenylate cyclase
  KO
K05851  adenylate cyclase, class 1 [EC:4.6.1.1]
Organism
ecle  Enterobacter cloacae ECNIH2
Pathway
ecle00230  Purine metabolism
ecle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecle00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECNIH2_01545 (cyaA)
Enzymes [BR:ecle01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     ECNIH2_01545 (cyaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylate_cycl Adenyl_cycl_N
Motif
Other DBs
NCBI-ProteinID: AIE62095
LinkDB All DBs
Position
311745..314288
Genome map
AA seq 847 aa AA seqDB search
MYLYIETLKQRLDAINQLRVDRALAAMGPAFQQVYSLLPTLLHYHHPLMPGYLDGNVPQG
ICLFTPDETQQHYLTELELYRGMPPQDSPKGELPITGVYSMGSTSSVGQSCSSDLDIWVC
HQSWLDNEERQLLQRKCSLLESWAASLGVEVSFFLIDENRFRHNESGSLGGEDCGSTQHI
LLLDEFYRTAVRLAGKRILWNMVPCDEEENYDDYVMSLYSQGVLTPNEWLDLGGLSSLSA
EEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPTPRLLAKDIKQRLHDGEIVSYGLD
AYCMMLERVTEYLTAIEDATRLDLVRRCFYLKVCEKLSRERACVGWRREVVSQLVKEWGW
DEERLAMLDNRANWKIDQVREAHNELLDAMMQSYRNLIRFARRNNLSVSASPQDIGVLTR
KLYAAFEALPGKVTLVNPQISPDLSEPNLTFIYVPPGRANRTGWYLYNRAPSMDSIISHQ
PLEYNRYLNKLVAWAWFNGLLTSRTRLFIKGNEVVDLAKLQEMVADVSHHFPLRLPAPTP
KALYSPCEIRHLAIIVNLEYDPTAAFRNQVVHFDFRKLDVFSFGEQQNCLVGSVDLLYRN
SWNEVRTLHFNGEQAMIEALKTILGKMHQDAAPPDSVEVFCYSQHLRGLIRTRVQQLVSE
CIELRLSSTRQETGRFKALRVSGQTWGLFFERLNVSVQKLENAIEFYGAISHNKLHGLSV
QVETNHVKLPQVVDGFASEGIIQFFFEESGDNAGFNIYILDETNRAEVYHHCEGSKEELV
RDVSRFYSSSHDRFTYGSSFINFNLPQFYQIVNVDGRAQVIPFRTQAITPAAPANQETAP
LLQQYFS
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
ttgtacctctatattgagactctgaaacagagactggatgccatcaatcaattgcgtgtg
gatcgcgcgcttgctgccatgggccctgctttccagcaggtatacagtctactgccaaca
ttgttgcactatcaccatccgctgatgccgggttaccttgatggtaacgttccccagggc
atttgcctcttcacgcctgatgaaacccaacagcattacctgactgaacttgaactctac
cgtggtatgccgccgcaggattcgccgaaaggcgagctgccgattaccggggtttactcc
atgggcagcacgtcatcggttgggcaaagttgctcttctgacctggatatctgggtctgc
catcagtcctggctcgacaatgaagagcgccagctgttgcagcgtaaatgcagcctgctg
gagagctgggcggcgtcgctcggcgtggaagtgagcttcttcctgattgatgaaaatcgt
ttccgccataacgaaagcggcagtctgggtggtgaagactgcggctcgactcagcacatc
ctgttgctggatgagttttaccgtactgccgttcgcctggccgggaaacgtattctgtgg
aatatggtgccgtgcgatgaagaagagaattatgacgactacgtcatgtcgctttactcg
cagggcgttctgacgccaaacgagtggctggatctgggcggcctgagctccctgtccgcc
gaagagtactttggcgcaagcctctggcagctttataagagcattgattcaccgtacaaa
gcggtgctgaaaaccctgctgctggaagcctactcctgggagtaccccacgccgcgcctg
ctggcgaaagatattaaacagcgtctgcacgacggggagatcgtctcctacgggcttgat
gcctactgcatgatgctggaacgcgtcaccgaatacctgacagccattgaggacgccacg
cgtcttgacctggtgcgtcgatgtttctatctcaaagtctgtgaaaaactgagccgcgaa
cgcgcctgcgtgggctggcgtcgtgaagtcgtcagccagttagtcaaagagtggggatgg
gacgaagagcgtctcgccatgctcgacaaccgcgccaactggaagatcgatcaggtgcgt
gaggcgcacaacgaactgcttgatgcgatgatgcagagctaccgcaacctgatccgcttt
gcccgccgtaacaaccttagcgtttctgccagcccacaggatatcggggtgctgacccgc
aaactgtacgccgcgtttgaagcgttgccgggcaaggtaacgctggttaacccacagatt
tcgcctgacctgtctgaaccgaatctgacctttatctacgtaccgccgggccgcgcgaac
cgcaccgggtggtatctgtacaaccgtgcgccaagcatggattcgatcatcagccatcag
ccgctggagtataaccgctacctgaacaagctggtggcctgggcctggtttaacggcctt
ctcacttcacgtacccggttgtttatcaaaggcaacgaggtggtcgatttagccaagttg
caggagatggtggcggatgtctcgcaccacttcccgctgcgtctgcctgcgccgacgcca
aaagcgctctacagcccgtgtgagattcgccatctggcgatcatcgtcaacctggaatac
gacccgacggcggccttccgcaatcaggtggttcactttgacttccgcaagctggacgtc
tttagctttggcgagcagcaaaactgcctggtgggcagcgtggatctgctgtaccgcaac
tcgtggaacgaagtgcgtaccctgcactttaacggcgagcaggcgatgatcgaggcgctg
aaaacgatcctcggcaagatgcaccaggacgccgcgccgccggacagcgtggaggtgttc
tgctacagccagcacctgcgcggcctgattcgtacccgcgttcagcagctggtgtctgag
tgcatcgaactgcgtctctccagcacccgacaggaaaccgggcgctttaaagccttgcgc
gtctccggccagacctgggggctgttctttgagcgcctgaacgtgtcggtgcagaagctg
gaaaacgccattgaattctacggcgcgatttcacacaacaaactgcatggcctgtcggtc
caggtggaaaccaatcacgttaagctgccgcaggtggtggatggctttgcgagtgaaggg
attattcagttcttcttcgaagagtcgggcgataacgccgggtttaacatctacattctg
gatgaaaccaaccgtgccgaggtgtatcaccactgcgaaggcagcaaagaggagctggtg
cgcgacgtcagccgcttctattcgtcctcgcacgatcgctttacctacggctcaagcttt
atcaacttcaacctgccgcagttctaccagattgtgaatgtggatgggcgagcgcaggtg
atcccgttccgtacgcaggcgattaccccggcggcgcccgctaaccaggaaactgcgccg
ctgttgcagcagtatttttcctga

DBGET integrated database retrieval system