KEGG   Enterobacter cloacae ECNIH2: ECNIH2_04540Help
Entry
ECNIH2_04540      CDS       T03471                                 

Definition
(GenBank) cell division protein MraZ
  KO
K03925  MraZ protein
Organism
ecle  Enterobacter cloacae ECNIH2
Brite
KEGG Orthology (KO) [BR:ecle00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    ECNIH2_04540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MraZ
Motif
Other DBs
NCBI-ProteinID: AIE62658
LinkDB All DBs
Position
929523..929981
Genome map
AA seq 152 aa AA seqDB search
MFRGATLVNLDSKGRLSVPTRYRDQLIENASGQLVCTIDINSPCLLLYPLPEWEIIEQKL
SRLSSMNPQERRVQRLLLGHASECQMDSAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW
DETTWYQQVKEDIDAEQSDSATLSERLRDLSL
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgttccgtggagcaacgttagtcaatctcgacagcaaagggcgtttatcggtaccaacc
cgatatcgcgaccagctgattgagaacgcttcgggtcaactggtttgcaccattgacatc
aactccccctgcctgctgctttaccctttgcctgaatgggaaatcattgagcaaaagctg
tcgcgactgtcgagcatgaacccgcaggaacgccgcgtacagcggctgttattgggacat
gccagtgaatgtcagatggatagcgccgggcgattattgattgcgcctgtgttgcggcaa
catgccggtctgactaaagaagtgatgctggtcgggcagttcaacaagtttgaactgtgg
gacgaaacgacctggtatcaacaggtcaaggaagatatcgacgctgagcagtctgattcc
gcaacattatcggaacggctgcgggacttgtctctataa

DBGET integrated database retrieval system