KEGG   Enterobacter cloacae ECNIH2: ECNIH2_05050Help
Entry
ECNIH2_05050      CDS       T03471                                 

Definition
(GenBank) hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ecle  Enterobacter cloacae ECNIH2
Pathway
ecle00061  Fatty acid biosynthesis
ecle00780  Biotin metabolism
ecle01100  Metabolic pathways
ecle01212  Fatty acid metabolism
Module
ecle_M00083  Fatty acid biosynthesis, elongation
ecle_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ecle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ECNIH2_05050
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ECNIH2_05050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecle01004]
    ECNIH2_05050
Enzymes [BR:ecle01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     ECNIH2_05050
Lipid biosynthesis proteins [BR:ecle01004]
 Fatty acid synthase
  Component type
   ECNIH2_05050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas PS-DH
Motif
Other DBs
NCBI-ProteinID: AIE62759
LinkDB All DBs
Position
1047198..1047653
Genome map
AA seq 151 aa AA seqDB search
MTTDTHTLHIEEILELLPHRYPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVAMVDGKVVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctgcatattgaagagattttagaacttctgccgcaccgc
tatccgtttttactggtagaccgtgtgctggattttgaagaaggtcgttttctgcgcgca
gtgaaaaatgtctccgttaacgagccgttcttccaggggcacttccctggtaagcctatc
ttcccgggtgtattgatcctggaagcgatggcacaggctaccggtattctggcgtttaaa
agcgtaggtaaactggaaccgggtgaactctattacttcgcgggtatcgatgaagcgcgc
ttcaagcgtccggtcgtgcctggtgatcaaatgatcatggaagtcacttttgaaaaaacg
cgtcgcggcctgactcgcttcaaaggcgtagctatggttgacggcaaagttgtttgcgaa
gcgacaatgatgtgtgcgcgtagccgggaggcctga

DBGET integrated database retrieval system