KEGG   Enterobacter cloacae GGT036: EC036_01410Help
Entry
EC036_01410       CDS       T03429                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
eclg  Enterobacter cloacae GGT036
Pathway
eclg00260  Glycine, serine and threonine metabolism
eclg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EC036_01410
Enzymes [BR:eclg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     EC036_01410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 HI0933_like FAD_binding_2 Pyr_redox_3 FAD_oxidored Methyltransf_16 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AIV27788
UniProt: A0A421IJF6
LinkDB All DBs
Position
143641..144666
Genome map
AA seq 341 aa AA seqDB search
MKALSKLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHIYNWDQWSQKTIPVPMV
VGHEYVGEVVGIGQEVKGFNIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGC
FAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDLVGEDVLVSGAGPIGIMAA
AVAKHVGARNVVITDVNEYRLSLARKMGVTRAVDVSKESLADVMEELGMTEGFDVGLEMS
GAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWNKVIFKGLFIKGIYGREMFETWYKMAA
LIQSGLDLSPIITHRFSVDDFQKGFDAMRSGQSGKVILSWD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttatccaaactgaaagcggaagaagggatttggatgaccgacgtgccggag
ccggaagtcggtcataacgatctgctgatcaaaattcgtaaaaccgccatttgcggcact
gacgttcatatctacaactgggatcagtggtcgcaaaaaaccattccggtacccatggtt
gtcggccacgaatacgttggtgaagtggttgggattggtcaggaagtgaaaggttttaac
attggcgaccgcgtctcgggtgaaggacacatcacctgcggccactgccgtaactgccgc
ggtgggcgtacgcacctgtgccgtaataccattggcgtgggcgtgaaccgtccgggttgc
tttgccgagtacctggtgatcccggcctttaacgcgttcaaaattccggacaacatttct
gacgatctggcctccatctttgacccgttcggcaacgcggtacatacggcgctctctttc
gacctggtcggcgaggatgtgttggtctccggcgcgggccctatcgggattatggccgca
gcggtggcgaagcacgtgggtgcgcgtaatgtagtgattaccgacgtgaacgaataccgt
ctgtcgctggcccgcaagatgggcgtcacccgtgcggtggatgtctctaaagagagcctg
gccgatgtgatggaagagctgggcatgaccgaagggtttgacgtgggtctggagatgtcc
ggcgcaccaccggcgttccgtaccatgctggataccatgaaccacggcggtcgtattgcg
atgctgggtattccgccgtcggatatgtctatcgactggaataaagttatcttcaaaggg
ctgttcattaaaggcatctatggccgtgaaatgttcgaaacctggtataagatggcggca
ttaattcagtctggtctggatctgtccccgattattacacatcgtttctccgttgatgat
ttccagaaaggctttgacgcgatgcgttcgggccagtccgggaaggttattttgagctgg
gattaa

DBGET integrated database retrieval system