KEGG   Enterobacter cloacae GGT036: EC036_02260Help
Entry
EC036_02260       CDS       T03429                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
eclg  Enterobacter cloacae GGT036
Brite
KEGG Orthology (KO) [BR:eclg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:eclg03012]
    EC036_02260
   03029 Mitochondrial biogenesis [BR:eclg03029]
    EC036_02260
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eclg04147]
    EC036_02260
Translation factors [BR:eclg03012]
 Eukaryotic Type
  Elongation factors
   EC036_02260
 Prokaryotic Type
   EC036_02260
Mitochondrial biogenesis [BR:eclg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    EC036_02260
Exosome [BR:eclg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   EC036_02260
  Exosomal proteins of breast cancer cells
   EC036_02260
  Exosomal proteins of colorectal cancer cells
   EC036_02260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AIV27873
UniProt: A0A2R3KP17
LinkDB All DBs
Position
241129..242313
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgcaatcactaccgttctggcaaaaacctac
ggtggttctgctcgtgcattcgaccagatcgataacgcaccagaagaaaaagctcgtggt
atcaccatcaacacctctcacgttgagtatgacaccccgactcgccactacgcacacgta
gactgcccaggccacgccgactatgttaaaaacatgatcaccggtgctgcgcagatggac
ggcgcgatcttggtagtagctgcgactgacggcccaatgcctcagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttccttacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggtagagatggaagttcgtgaactgctgtctcag
tacgatttcccaggcgacgataccccaatcgttcgtggttccgcgctgaaagcgctggaa
ggcgacgcagagtgggaagcgaaaatcatcgaactggctggctacctggattcttacatt
ccagaaccagagcgtgcgattgataagccattcttgctgccaatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaagtgggt
gaagaagttgaaatcgttggtatcaaagagactgcgaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgttggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggttctggcgaagccaggctcaatcaag
ccacacaccaagttcgaatctgaagtgtacatcctgtccaaagacgaaggcggccgtcat
actccgttcttcaaaggctaccgtccacagttctacttccgtacaactgacgtgaccggt
accatcgaactgccagaaggcgtagagatggtaatgccaggcgacaacatcaagatggtt
gtgactctgatccacccaatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggt
ggccgtaccgttggcgcgggcgtggttgctaaagttctcggctaa

DBGET integrated database retrieval system