KEGG   Enterobacter cloacae GGT036: EC036_02990Help
Entry
EC036_02990       CDS       T03429                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
eclg  Enterobacter cloacae GGT036
Pathway
eclg00473  D-Alanine metabolism
eclg01100  Metabolic pathways
eclg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eclg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EC036_02990
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    EC036_02990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eclg01011]
    EC036_02990
Enzymes [BR:eclg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     EC036_02990
Peptidoglycan biosynthesis and degradation proteins [BR:eclg01011]
 Precursor biosynthesis
  Racemase
   EC036_02990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIV27946
LinkDB All DBs
Position
326224..327303
Genome map
AA seq 359 aa AA seqDB search
MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGITQPILLLEGFFEAADLPTIADQHLHTAVHNEEQLSALETAELSEPVTVW
MKLDTGMHRLGVRPEHAQAFYQRLCQCKNVRQPVNIVSHFARADEPDCGATEQQLDIFNT
FCEGKPGMRSIAASGGILLWPQSHFDWARPGIILYGVSPLENRPWGPDFGFQPVMSLVSK
LIAVREHKAGEPVGYGGTWTSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVKIVGR
VAMDMICVDLGPDAQDKAGDDVVMWGDGLPVERIAEITKVSAYELITRLTSRVAMKYID
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggcaactgttgtgattaaccgccgcgctctgcgacacaacctgcaacgtctg
cgtgaactggctcctgccagtaaacttgttgcagtcgtgaaagcgaacgcttacggacac
ggtcttcttgagaccgcgcgaacgctccccgatgccgacgcctttggcgttgcccgtctt
gaagaagccctccgtctgcgcgcgggggggatcacccaaccgattttgctgctcgaaggc
ttttttgaggctgcagacctgccgaccattgcagaccagcatctgcacacggcggtacac
aacgaagaacagctttccgccctcgaaaccgctgagctgagcgagccagtcaccgtctgg
atgaagctcgacacgggcatgcaccgtctgggcgtacgtccggaacacgcgcaggcgttt
tatcagcgtctgtgccagtgcaaaaatgtccgccagccggtaaatattgtcagtcatttt
gcccgggctgatgagcctgactgcggcgctactgaacaacaactcgacatctttaacacc
ttctgcgaaggcaagccggggatgcgttctatcgcggcctccggtggcattctgctgtgg
ccgcagtcgcacttcgactgggcgcgtccggggattattctttacggcgtatcgccgctg
gagaacagaccctgggggccggactttggcttccagccggtgatgtccctggtgtctaag
ctgattgcggtgcgtgagcacaaggcgggggaaccggtgggttacggcggcacctggacc
agcgagcgtgacacccggctgggtgtggtggcgatggggtatggcgacggttatccacgt
gctgcgccgtccggtacgccggttctggtcaatggccgcgaagtgaagattgtcggtcgc
gtggcgatggacatgatttgcgtagatctgggccccgatgcccaggataaagcgggcgac
gatgtggtgatgtggggtgacggtttgcccgtcgaacgcatcgcggaaatcacgaaagtg
agtgcttacgaacttataacgcgcctgacatcaagggtggcaatgaagtacatcgattaa

DBGET integrated database retrieval system