KEGG   Enterobacter cloacae GGT036: EC036_03110Help
Entry
EC036_03110       CDS       T03429                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
eclg  Enterobacter cloacae GGT036
Pathway
eclg00480  Glutathione metabolism
eclg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EC036_03110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eclg02000]
    EC036_03110
Enzymes [BR:eclg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     EC036_03110
Transporters [BR:eclg02000]
 Other Transporters
  Pores ion channels [TC:1]
   EC036_03110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: AIV27958
UniProt: A0A1B3EWM0
LinkDB All DBs
Position
338546..339217
Genome map
AA seq 223 aa AA seqDB search
MLTVHHLNQSRSHRVIWALEELSLPYEIVHYQREKTMLAPESLKRVHPLGKSPVIEDNGL
ILAESGAILEYLQETYDAESQLKPLDPAHKVQYRFWLHYAEGSLMPLLLMKLVFSSLGKP
PVPFGIRTLGKALGQGVQKAYLNPQLETHARFIESHLAENSWFAGETLSMADIQMSFPIF
ALLARGGVEDLPHTHAWKKKVENRPAWQRTLEQGGPLTIPGEA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgctcacggtacatcaccttaaccagtcgcgctcacaccgcgtgatctgggctctggaa
gaactttctctgccctatgagattgttcactaccagcgcgaaaaaacgatgctggctccc
gagtcccttaaacgcgtgcatccgttgggcaagtcaccggtcattgaagacaacggactg
atccttgctgaatccggtgccattctggagtatctgcaggaaacctacgacgcagaatcg
cagcttaagccgctggatcctgcccacaaggtgcaataccgcttctggctacactatgca
gaaggttctcttatgccgctgctgttaatgaagctggtatttagcagcctcggtaaaccg
cccgtgccgtttggaatacgcacgctggggaaagcgctgggtcagggtgtgcaaaaagcc
tatctcaatccccagctcgaaacccacgcgcgttttattgaatctcacctggctgaaaat
agctggtttgccggagagactctcagcatggccgatattcagatgagtttcccgattttt
gccctgctggcgcgtggcggtgtcgaggatcttccgcacacccatgcctggaagaaaaag
gtcgaaaatcgtcctgcctggcagagaaccctggaacaaggtgggccattaacgatccct
ggcgaggcgtaa

DBGET integrated database retrieval system