KEGG   Enterobacter cloacae GGT036: EC036_09490Help
Entry
EC036_09490       CDS       T03429                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
eclg  Enterobacter cloacae GGT036
Pathway
eclg00330  Arginine and proline metabolism
eclg01100  Metabolic pathways
eclg01110  Biosynthesis of secondary metabolites
eclg01130  Biosynthesis of antibiotics
eclg01230  Biosynthesis of amino acids
Module
eclg_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:eclg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    EC036_09490
Enzymes [BR:eclg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     EC036_09490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 Sacchrp_dh_NADP Shikimate_DH GFO_IDH_MocA PDH 2-Hacid_dh_C 3HCDH_N NAD_Gly3P_dh_N IlvN FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AIV28596
LinkDB All DBs
Position
complement(1044381..1045190)
Genome map
AA seq 269 aa AA seqDB search
MDKKIGFIGCGNMGKAILGGLIASGQVLPGQIWVYTPSPDKVAALRDEYGINAAESAQEV
AQVADIVFGAVKPNIMIKVLSEITSSLNKDTLVVSIAAGVTLDQLARALGHDRKIVRAMP
NTPSLVNAGMTSITPNALVTTEDVADVLNIFRCFGEAEVIAESMIHPVVGVSGSAPAYVF
MFLEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLETGKHPGELKDMVCSPGGTTIEAV
RVLEERGFRASVIEAMAKCMEKSEKLSKS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggataagaaaatcgggtttattggctgcggtaacatgggcaaagccatcctgggtggc
ctgatcgccagcgggcaggtcctgccgggtcagatttgggtctatacaccatcaccggat
aaagtcgcggcgttacgtgatgagtatggtattaacgcagccgaaagcgcgcaggaagtg
gcccaggtcgccgatatcgtctttggggcggttaaaccgaatatcatgatcaaagtcctg
agcgagatcacctccagcctgaataaagacacgctggtggtgtcgattgccgcaggcgtg
acgctcgatcagctggcccgtgcactgggtcatgaccgtaaaattgttcgcgcaatgccc
aataccccttcgctggtcaacgccgggatgacctccatcacccctaacgcgctggtgacc
acggaagatgtggccgatgtgctgaacattttccgctgcttcggcgaagcggaagtgatt
gccgaatcgatgatccatccggttgtgggcgtgagtggttctgctcctgcgtatgtcttc
atgttcctggaagcgatggcggatgctgcggtgcttggcggtatgccacgtgcgcaggcc
tataaatttgccgcacaggcggtgatgggctcagccaaaatggtgctggaaaccggtaag
catccaggggaactgaaagatatggtctgctcgcctggcggtaccaccatcgaagcggtg
cgggtgctggaagagcgcgggttccgtgcgtcggtcattgaagcgatggcgaaatgcatg
gaaaagtcagagaagctgagtaagtcctga

DBGET integrated database retrieval system