KEGG   Enterobacter cloacae GGT036: EC036_15010
Entry
EC036_15010       CDS       T03429                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
eclg  Enterobacter cloacae GGT036
Brite
KEGG Orthology (KO) [BR:eclg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:eclg03009]
    EC036_15010
Enzymes [BR:eclg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     EC036_15010
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     EC036_15010
Ribosome biogenesis [BR:eclg03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    EC036_15010
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_25 Methyltransf_31 Methyltransf_11 MTS Methyltransf_24 Methyltransf_15 N6_Mtase
Other DBs
NCBI-ProteinID: AIV29148
LinkDB
Position
1647274..1649382
AA seq 702 aa
MNSLFASTARGLEELLKTELEALGAQECQVVQGGVHFEGDTRLIYQSLMWSRLASRIMLP
MKECKVYSDLDLYTGVQMIDWTEIFTPDATFAVHFNGVNDEIRNSQYGALRVKDAIVDCF
TRKNKERPNVDRENPDLRINVWLNGDTASISLDLSGAGLHLRGYRDRTGMAPIKETLAAA
IVMRSGWLPGTPLLDPMCGSGTLLIEAAMLATDRAPGLHRGHWGFSGWAQHDETLWKEVK
AEAQARARKGLAEYTSHFYGSDSDPRVIERARSNARRAGIGELVTFEVKDVANLTNPLPK
GPYGTVISNPPYGERLDSEPALIALHSLLGRNMKDYFGGWNLSLFSASPELLSCLQLRAD
RQFKAKNGPLDCVQKNYHLAEKAADSKPSGVAEDYANRLRKNLKKFEKWAKQEGIECYRL
YDADLPEYNVAVDRYADWVVIQEYAPPKTIDAQKARQRMLDVIAATIAVLGIAPNKLVLK
TRERQKGKNQYQKMGEKGDFIEVGEYNARLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK
DFLNLFSYTGSASVHAGLGGARSTTTVDMSRTYLEWAERNLRLNGLTGRQHRLMQADVLG
WLRDTDEQFDLIFIDPPTFSNSKRMEDSFDVQRDHLRLMTDLKRLLRKGGTIMFSNNKRG
FRMDHDGLAALGLKAQEISQKTLSQDFARNRQIHNCWLITAA
NT seq 2109 nt   +upstreamnt  +downstreamnt
atgaattctctgtttgccagtacggcccgtgggctggaagagctgttaaaaactgaactg
gaagccttgggcgcgcaagagtgccaggtggttcagggtggtgtccattttgagggcgac
acacggcttatttaccagagcctgatgtggagccgcctggcgtcgcgcatcatgctgccg
atgaaagagtgcaaggtctacagcgatcttgatctctataccggcgtacagatgatcgac
tggacagagatcttcacgccagacgcgaccttcgcggtgcattttaacggtgtaaacgat
gagatccgcaacagccagtacggcgcgctgcgcgtgaaagatgccatcgtggactgcttt
acccgtaaaaacaaagaacgaccaaacgtcgatcgtgaaaacccggatctgcgcattaac
gtctggctcaatggcgataccgccagcatctctctggatctgagcggggcaggtctgcat
ctgcgtggctaccgcgatcgcaccggtatggcgcccatcaaagaaacgctggctgccgcc
atcgtgatgcgctccggctggctgccgggcacgccgctgctcgatccaatgtgtggttcc
ggtacgctgctgattgaagccgcgatgctggccaccgaccgcgctcccggcctgcatcgc
ggccactggggctttagcggctgggcgcagcacgatgaaacactctggaaagaggtcaaa
gccgaagcgcaggcccgtgcgcgtaaaggcctggcggagtacacctcccatttctatggc
tctgacagcgacccgcgcgtcattgaacgcgcgcgcagcaatgcccgtcgcgcaggtatc
ggtgagctggtgaccttcgaagtgaaagatgtcgcgaacctgaccaacccgctgccgaaa
ggcccctacggtaccgttatcagcaacccgccatacggcgagcgtctggatagcgaaccg
gcgctgattgctctgcacagcctgctgggccgcaatatgaaagactactttggcggctgg
aatctctccctgtttagcgcttcaccagaactgctgagctgtctgcagctgcgtgccgat
cgccagtttaaggcgaagaacggcccgctggactgtgtgcagaaaaactaccatctggcg
gagaaagcggcggacagcaaaccgtcgggcgtggcggaagattacgctaaccgtctgcgc
aagaacctgaagaaatttgaaaaatgggccaaacaggaaggcattgaatgctatcgcctg
tatgacgccgatctgccggagtacaacgtggcggttgaccgctatgcagactgggtggtg
attcaggaatatgctccaccaaaaaccattgatgcgcaaaaagcgcgccagcgcatgctg
gacgtgatcgcagcgacgattgccgtgcttggcatcgcgccaaacaaactggtgctgaaa
acccgcgagcgtcagaaagggaaaaaccagtatcagaagatgggtgagaagggtgacttt
attgaagtgggcgaatacaacgctcgcctgtgggttaacctgacggattacctcgatacc
gggctgttcctcgaccaccgcattgcccgtcgtatgctgggccagatgagcaaaggtaag
gacttccttaacctgttttcctacaccggtagcgccagcgtgcatgcgggcctgggcggc
gcgcgcagcacaactacggtggatatgtcgcgcacctatctggagtgggcggagcgcaac
ctgcgtctcaatggcctgaccggacgccagcatcgtctgatgcaggccgatgtcctgggc
tggctgcgtgacaccgatgaacagttcgatctgatcttcatcgatccgccaacgttctcc
aactccaagcgtatggaggatagctttgatgtacaacgcgatcacctgcgcctgatgacc
gacctgaagcgcctcctgcgtaaaggcggcacgattatgttctcgaataacaaacgcggt
ttccgcatggatcacgacggcctggccgctctgggactgaaagcacaagaaatcagccaa
aaaacgctgtctcaggactttgcccgtaatcgtcagatccataactgctggcttatcacc
gcggcctga

DBGET integrated database retrieval system