KEGG   Enterobacter cloacae GGT036: EC036_20970Help
Entry
EC036_20970       CDS       T03429                                 

Definition
(GenBank) glycosidase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
eclg  Enterobacter cloacae GGT036
Pathway
eclg00500  Starch and sucrose metabolism
eclg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EC036_20970
Enzymes [BR:eclg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     EC036_20970
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     EC036_20970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AIV29744
UniProt: A0A1B3F155
LinkDB All DBs
Position
complement(2280885..2282510)
Genome map
AA seq 541 aa AA seqDB search
MAGWHTRAIIYQIDTALFYDLNGDGCGDIAGITAKLRYIRRMGATVIWITPFYLTPFLDE
GYDVSDHLQVDPRFGKLADIIAFIEQARELGMQVIIELLIQHTSDAHPWFQEARRNPKSP
FRDYYLWSDNDDDDTPPMFPGVEKSIWTWDDEAGQYYRHMFYRHEPDLNLTSPAVIKEIE
NIILFWLKLGVSGFRLDAASHLTTQAGSGDEKKGLWILEHLRRLITQHNPQAILLGEVDV
EVEAYKDYFGNNDRLHLVLNFWLNKYFYVSLARKSARPLRNAVKKMIVPPDSCCFANWLR
NHDELDLEGIGKKDKQFVLDTFAPDEEMNVYQRGIRRRLAPMLNGDQKRLALCHAVLFSL
PGVPVMRYGDEIGMGDDLDLEERYAVRTPMQWAPSQGGGFSDADPQSFIAPIIDHGPYRY
QKINVADSLLHRNSLLHRIIDIANTRSEFPEIAVAPFHLIAIDNDAVLGIYYEAEDRSIL
TFVNFSDKPVTFTARGIRHATWTACLADKRYEDALVCGKTVELDIGGYGYRWFWTNRSAL
R
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcaggatggcatacacgggccattatttatcaaattgatacggcactgttttacgat
ttaaacggcgatggctgcggagacatcgccggaataacggccaaattgcgatatatacgc
cgcatgggggcgacagtaatctggatcactccgttttaccttaccccttttctggacgaa
gggtatgacgtcagcgaccacctgcaggtcgatccccggttcggcaaactggcggatatt
atcgcttttattgagcaggcacgtgagctggggatgcaggtcattatcgaactgttgatc
cagcatacgtcggacgcccacccctggtttcaggaggcccggcgcaacccgaaatccccc
tttcgcgactattatctgtggtcagataatgacgatgacgatacgcctccgatgttcccg
ggcgtggaaaagagcatctggacatgggatgacgaagcgggccaatactaccggcatatg
ttttatcgccacgagccggatctcaacctcacctcacctgcggtcattaaagagatagag
aacattatcctcttctggcttaagctcggcgtatcgggattccgtctggacgccgcgtcg
catctcaccacccaggccggaagcggtgacgagaaaaaggggctgtggatcctggagcac
ttgcgccgcctgattacccaacataacccgcaggcgatcctgctcggtgaagttgacgta
gaagtggaagcctacaaagactatttcggcaataacgaccgccttcatctggtgcttaac
ttctggcttaacaaatatttctacgtgagcctggccaggaaaagcgcccgcccgctgcgc
aatgcggtgaagaaaatgatcgtcccgccagactcctgctgctttgccaactggttgcgt
aaccacgacgagctggatctggaagggatcggtaaaaaggataaacagttcgtcctcgac
acgttcgccccggatgaagagatgaacgtgtaccagcgtgggatccgccgtcgcctggcg
ccgatgctgaatggcgaccagaagcggctggcgctctgccacgccgtgctgttctccctg
cccggggtgcccgttatgcgctacggggatgaaatcggcatgggtgatgatctggattta
gaagagcgttacgccgtgcgtacgcccatgcagtgggcgccctctcagggcggtggcttc
tctgacgcagacccgcagagctttatcgcgcccatcattgaccacgggccctatcgttat
cagaaaattaacgtggcggattcgctgctgcaccgcaactcgctgctgcaccggattatc
gatatcgccaacacgcggtctgaattcccggagattgccgtggcaccgtttcatcttatc
gccatcgataatgatgcagtgctgggaatttactacgaggctgaagatcgcagcattctt
acctttgttaatttcagcgataaaccggtgaccttcaccgccagagggatccgccacgcc
acatggaccgcctgtctggcagacaaacgctacgaggatgcgctggtctgcggcaaaacc
gttgagctggatataggcggctacggctatcgctggttctggacaaaccgtagcgcgctg
cgctga

DBGET integrated database retrieval system