KEGG   Enterobacter cloacae GGT036: EC036_22620
Entry
EC036_22620       CDS       T03429                                 

Definition
(GenBank) hypothetical protein
  KO
K11208  GST-like protein
Organism
eclg  Enterobacter cloacae GGT036
Brite
KEGG Orthology (KO) [BR:eclg00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    EC036_22620
SSDB
Motif
Pfam: GST_N_2 GST_N_3 GST_N GST_C GST_C_3 GST_C_2
Other DBs
NCBI-ProteinID: AIV29909
LinkDB
Position
complement(2458888..2459505)
AA seq 205 aa
MITLYGAPGWGSVISEVMLTLADIPYEFINVDGFDAPGPQRELLQRLNPLCQVPTLALEN
GAIMTETAAIALMVLDRCPDLAPPVGQAERQQFQRLLIWFVANVYPTFTYADYPERWVPD
APEQLKKNCIEYRKSLYLWFDSQLKAAPFALGEQLTLLDVYIAVARTWGPRHAWFAENTP
KITAIADAVCQLPELHKVLKANGII
NT seq 618 nt   +upstreamnt  +downstreamnt
atgatcacactttatggtgcacccggctggggctcggtaatcagcgaagtgatgctgact
ctggcagacatcccttacgagtttattaatgtggacgggtttgatgcgcccggtccgcag
cgcgaattgctgcaaagactcaatccattgtgtcaggtgccgacactggcgctggaaaat
ggcgcgatcatgaccgaaacagccgccatcgccctgatggtgctcgacaggtgtcccgat
ctggcgccgcccgtcggacaggcagaacgtcagcaatttcaacgcttgcttatctggttt
gtcgcgaacgtctatccgacctttacctatgctgattatcccgaacgctgggtgcctgac
gcaccggaacaactgaagaaaaattgtatcgaataccgcaaatccctctatttgtggttc
gatagccagctcaaagcggccccgtttgcgctgggtgaacagcttacgctactcgacgtc
tatattgcggtcgcacgtacctgggggccacggcatgcgtggtttgccgagaatacgcca
aagataacggccattgcagacgccgtgtgtcagcttcctgaactgcacaaggtgttaaag
gcaaacggcattatctga

DBGET integrated database retrieval system