KEGG   Enterobacter cloacae GGT036: EC036_24160Help
Entry
EC036_24160       CDS       T03429                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
eclg  Enterobacter cloacae GGT036
Pathway
eclg00061  Fatty acid biosynthesis
eclg00780  Biotin metabolism
eclg01100  Metabolic pathways
eclg01130  Biosynthesis of antibiotics
eclg01212  Fatty acid metabolism
Module
eclg_M00083  Fatty acid biosynthesis, elongation
eclg_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:eclg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    EC036_24160
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    EC036_24160
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    EC036_24160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:eclg01004]
    EC036_24160
Enzymes [BR:eclg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     EC036_24160
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     EC036_24160
Lipid biosynthesis proteins [BR:eclg01004]
 Fatty acid synthase
  Component type
   EC036_24160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AIV30063
UniProt: A0A1B3F1S6
LinkDB All DBs
Position
2624748..2625536
Genome map
AA seq 262 aa AA seqDB search
MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSSIV
LECDVAQDESIDGMFAELAKSWDKFDGFVHSIGFAPGDQLDGDYVNAVTRDGFKIAHDIS
SYSFVAMAKSCRAMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFNIAAMNELEIK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctttccggtaagcgcattctggtaaccggcgttgccagcaaactgtccatc
gcatacggcatcgcacaggcaatgcatcgcgaaggcgctgagctggcgttcacctaccag
aacgacaagctgaaaggccgtgttgaagaatttgccgcgcagctgggttccagcattgtt
ctggaatgtgacgttgcacaagatgaaagcatcgatggcatgtttgctgaactggcaaaa
tcgtgggataaatttgacggtttcgttcactccatcggcttcgcacctggcgaccagctg
gacggtgactacgtgaacgcggtaacccgcgatggctttaaaatcgctcacgacattagc
tcttacagctttgttgcgatggcgaaatcttgtcgtgccatgctgaacccgggctccgcc
ctgctgaccctgtcctacctgggcgcagagcgcgcaatccctaactacaacgtgatgggt
ctggctaaagcgtctctggaagcaaacgtccgctacatggcgaacgcaatgggccctgaa
ggcgtgcgcgttaacgccatctctgcaggtccaatccgtaccctggcggcttccggtatc
aaagatttccgtaaaatgctggcacactgcgaagcggttaccccgattcgtcgtaccgtt
accattgaagatgtgggtaactctgcagcattcctgtgctctgacctttccgcgggtatc
tccggcgaagtggttcacgttgacggcggcttcaacatcgctgcaatgaacgagctggaa
attaaataa

DBGET integrated database retrieval system