KEGG   Enterobacter cloacae GGT036: EC036_31380Help
Entry
EC036_31380       CDS       T03429                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
eclg  Enterobacter cloacae GGT036
Brite
KEGG Orthology (KO) [BR:eclg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EC036_31380
Enzymes [BR:eclg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     EC036_31380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_2 GST_C_3 NADH_u_ox_C
Motif
Other DBs
NCBI-ProteinID: AIV30785
UniProt: A0A1B3F3F3
LinkDB All DBs
Position
3401610..3402239
Genome map
AA seq 209 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEAELEYRIIRVDISKGDQFRPLFLAISPNNKIPAIIDNLP
ADGGKPLSLFESGEILLYLAEKTGKLLSGELRERHHTLQWLFWQTSGLGPMLGQNHHFTA
YAPQPIPYAIERYQVETQRLYGVLNRRLEKSPWLGGDHYSIADIACWPWVNTHERHRIDL
ASYPAVNNWFERIRTRPATERAMKKIQEI
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctttattacgcccctactccaaacggccataagatcaccctctttcttgaa
gaagccgagctggaatacaggatcatccgcgtggatatcagcaaaggcgatcagttcagg
cctctctttctggccatctcaccgaacaacaaaatcccggccatcatcgataacctgcca
gctgatggcggcaaaccgttgagcctgtttgaatccggggagattttgctctatctggcg
gagaaaaccggcaaactgctgagcggggaactgcgcgagcgtcaccacacgctacagtgg
ctgttctggcagacaagcggcctgggcccgatgctggggcagaaccaccactttaccgct
tacgcgccacaacccatcccgtatgcgatagagcgctatcaggtggaaacgcagcggctg
tacggcgtactgaaccgtcggctggaaaaatcaccgtggctcgggggcgatcattacagt
atcgccgatatcgcctgctggccgtgggtgaatacccatgaacgtcaccgtattgattta
gcctcttacccggcggttaacaactggtttgaacgtatccgcacccgcccggcgaccgag
cgtgcgatgaaaaaaatccaggagatttag

DBGET integrated database retrieval system