KEGG   Enterobacter cloacae GGT036: EC036_40180Help
Entry
EC036_40180       CDS       T03429                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
eclg  Enterobacter cloacae GGT036
Pathway
eclg00061  Fatty acid biosynthesis
eclg00620  Pyruvate metabolism
eclg00640  Propanoate metabolism
eclg01100  Metabolic pathways
eclg01110  Biosynthesis of secondary metabolites
eclg01120  Microbial metabolism in diverse environments
eclg01130  Biosynthesis of antibiotics
eclg01200  Carbon metabolism
eclg01212  Fatty acid metabolism
Module
eclg_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:eclg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EC036_40180
   00640 Propanoate metabolism
    EC036_40180
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    EC036_40180
Enzymes [BR:eclg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     EC036_40180
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     EC036_40180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp_3 Dala_Dala_lig_C ATP-grasp GARS_A ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AIV31665
UniProt: A0A094YFF5
LinkDB All DBs
Position
4352448..4353797
Genome map
AA seq 449 aa AA seqDB search
MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSY
LNIPAIISAAEITGAVAIHPGYGFLSENANFAEQVERSGFIFIGPKADTIRLMGDKVSAI
TAMKKAGVPTVPGSDGPLTDDMDANRAHAKRIGYPVIIKASGGGGGRGMRVVRSDAELAQ
SISMTKAEAKAAFSNDMVYMEKYLENPRHIEIQVLADGQGNAIYLAERDCSMQRRHQKVV
EEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVT
EMITGVDLIKEQLRIAAGQPLSIKQEEVVVKGHAVECRINAEDPNTFLPSPGKITRFHAP
GGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDVAIARMKNALQELIIDGIKTNVDL
QMRIMSDEHFQNGGTNIHYLEKKLGLNEK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgctggataaaattgttatcgccaaccgcggcgagatcgcactgcgtattcttcgtgcc
tgtaaagaactgggcatcaagactgtcgctgtgcactcaagcgcggaccgcgatttaaaa
cacgtattgctggcggatgagacggtctgtatcggcccggctccgtccgtaaaaagctat
ctgaacatcccggcaatcatcagcgccgctgaaatcactggcgcggtggcaattcacccg
ggttatggcttcctctccgagaacgccaactttgctgagcaggttgaacgctctggcttt
atcttcatcggcccgaaagctgacaccatccgcctgatgggtgacaaagtgtctgcaatc
accgcgatgaaaaaagccggtgttccaaccgttccaggttctgacggcccgctgactgac
gacatggatgcaaaccgtgctcatgctaaacgcattggctacccggtgatcatcaaggcg
tccggcggcggcggcggtcgcggtatgcgcgtagtgcgcagcgacgctgaactggcacaa
tccatctccatgaccaaagcggaagcgaaagcagctttcagcaatgatatggtgtacatg
gaaaaatacctggaaaacccacgccacatcgaaattcaggtgctggcagacggtcagggt
aacgctatctatctggcagaacgtgactgctccatgcagcgtcgtcaccagaaagtggtc
gaagaagcaccagcaccgggcattaccccggaactgcgtcgctacatcggcgagcgttgt
gccaaagcgtgtgtcgacatcggctatcgcggggcgggtaccttcgaattcttgttcgaa
aacggtgagttctacttcattgagatgaacacccgtattcaggttgaacacccggttacc
gaaatgatcaccggcgttgacctgatcaaagagcagctgcgtatcgctgccggccagcct
ctgtccatcaaacaggaagaagtagtggtcaaaggccatgcggtcgagtgccgtatcaac
gccgaagacccgaataccttcctgccaagcccgggtaaaatcacgcgtttccacgcgccg
ggtggctttggcgtgcgttgggagtctcatatttacgccggttacaccgtaccgccgtac
tatgactcaatgatcggtaagcttatctgctacggcgaaaaccgtgacgtggcgattgcc
cgcatgaagaacgccctgcaggagctaatcatcgacggtatcaaaaccaacgttgatctg
cagatgcgcatcatgagcgacgagcacttccagaatggtgggacgaacatccactatctg
gagaaaaaactcggtctcaacgagaagtaa

DBGET integrated database retrieval system