KEGG   Enterobacter cloacae GGT036: EC036_41870Help
Entry
EC036_41870       CDS       T03429                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
eclg  Enterobacter cloacae GGT036
Pathway
eclg00250  Alanine, aspartate and glutamate metabolism
eclg00410  beta-Alanine metabolism
eclg00640  Propanoate metabolism
eclg00650  Butanoate metabolism
eclg01100  Metabolic pathways
eclg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eclg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EC036_41870
   00650 Butanoate metabolism
    EC036_41870
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EC036_41870
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EC036_41870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eclg01007]
    EC036_41870
Enzymes [BR:eclg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     EC036_41870
Amino acid related enzymes [BR:eclg01007]
 Aminotransferase (transaminase)
  Class III
   EC036_41870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIV31834
LinkDB All DBs
Position
complement(4520347..4521612)
Genome map
AA seq 421 aa AA seqDB search
MKNNELNDRRLQATPRGIGVMCNFYADKAENATVWDVEGNEYIDFAAGIAVLNTGHRHPK
IISAIEKQLHAFTHTAYQIVPYEGYVSLAERINARVPIDGPAKTAFFSTGAEAVENAVKI
ARAYTRRPGLIAFGGAFHGRTSMTMALTGKVAPYKLGFGPFPGSVYHAQYPNELHGVSTA
EALKSLERIFKADIAPDQVAAIILEPVQGEGGFNIAPADFMQALRALCDTHGILLIADEV
QSGFARTGKLFSMEHHCVKPDLITMAKSLAGGMPLSAVSGRAEVMDAPAPGGLGGTYAGN
PLAIAAAHAVLDVIDEDDLCTRSAHLGHHLVEVLNKAKEHCPYIADIRAQGSMVAVEFND
PQSGLPSPEFTRQVQERALQEGLLLLSCGVYGNVIRFLYPLTIPEVQFRKALDIISASLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaataacgaactgaacgaccggcgtttacaggcgacgccgcgcggcatcggcgtg
atgtgtaacttctatgccgataaagctgaaaacgccacggtgtgggacgtcgagggcaac
gagtatatcgactttgccgccggaatagcggtgctgaacaccgggcatcgccatccaaaa
atcatttccgccattgaaaaacaacttcatgccttcacccacacggcgtaccagattgtg
ccgtacgaaggctatgtgtcgcttgccgagcgaatcaacgcgcgtgtgccgattgacggc
ccggccaaaaccgccttcttctcaacgggggcagaagccgtcgaaaacgcggtaaaaatt
gcccgcgcatacaccagacgccctggcctgatcgcctttggcggtgcttttcatggacgc
acctcgatgaccatggcgctgacggggaaagttgccccttacaagctgggtttcgggccg
tttcctggctcggtatatcacgcccaataccccaatgaactgcacggtgtcagtacggcg
gaggcattaaaaagcctggagcgtatcttcaaagcggacattgccccggaccaggtcgcg
gccattattcttgaaccggttcagggtgagggcggtttcaatatcgcaccggcggatttt
atgcaggccttgcgcgccctgtgcgatacccacggtattttgctgatcgccgatgaggtg
caaagcggttttgcgcgtaccggaaaactgttctcgatggaacaccactgcgtgaagccg
gatctgatcaccatggcgaaaagcctggcgggtggcatgccgctctcggcagtgtcgggc
cgcgccgaggtgatggacgcgcctgcgcctggcggactgggcggtacctacgccggtaac
ccactggcgatcgccgccgcacatgccgtgctggacgtgattgatgaagacgatctttgt
acgcgctcggcgcacctgggtcatcatctggtggaagtactgaacaaagcgaaggaacat
tgtccgtatatcgcggatatccgcgcgcaaggctcaatggtggcggtggagtttaacgat
ccgcaatccgggctgccgtcaccggaattcacccgtcaggttcaggagcgagccctgcag
gaaggccttctgcttctgagttgcggcgtgtacggtaacgtcatccgtttcctctatccg
ctcacaatccctgaagtgcagttccgtaaagcgctggacattatttctgcgtcgctgact
cgttaa

DBGET integrated database retrieval system