KEGG   Enterobacter cloacae ECNIH5: ECNIH5_14795Help
Entry
ECNIH5_14795      CDS       T03706                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ecli  Enterobacter cloacae ECNIH5
Pathway
ecli00564  Glycerophospholipid metabolism
ecli01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecli00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECNIH5_14795
Enzymes [BR:ecli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ECNIH5_14795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 Pyr_redox_2 FAD_oxidored FAD_binding_3 DAO_C NAD_binding_8 Thi4 3HCDH_N HI0933_like Pyr_redox Pyr_redox_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AIX59955
UniProt: A0A2J0NZX9
LinkDB All DBs
Position
3154919..3156547
Genome map
AA seq 542 aa AA seqDB search
MTIHDPRFSDVIIIGGGATGAGIARDCALRGLSVTLLERHDIATGATGRNHGLLHSGARY
AVTDAESARECIAENQILRRIARHCVEPTNGLFITLPEDDLGFQQTFITACTAAGIQAEA
LDPAQARRLEPSVNPALLGAVKVPDGTVDPFRLTAANMLDAREHGAQILTGHHVTGLIRE
GNTVRGVRVCDTQYNEHRELYATVVVNAAGIWGQRIAEYADLSVRMFPAKGSLLILDHRI
NNHVINRCRKPSDADILVPGDTISLIGTTSMHVDYSEIDYNRVTAEEVDILLREGEKLAP
VMAQTRILRAYAGVRPLVASDNDPSGRNVSRGIVLLDHAERDGMDGFITITGGKLMTYRL
MAEWATDAVCRKLGNTAPCVTAERALPGSQQSTEKTLHKIISLPAPLRGSAIYRHGDRTP
TWLGEGRLSRSLVCECEAVTAGEVQYAVENLTVHNLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFHATSSTQSLAQLSDFLNERWKGIQPVAWGDALRESEFTRWVYQGLCGLEKEHNH
EI
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgactattcacgatccacgcttcagcgatgtgattatcattggcggtggcgcgacgggt
gccggcatcgcacgcgactgcgccctgcggggattgagcgtcacgcttctggaacgccac
gacatcgccaccggcgcaacggggcgtaaccacggtctgttgcacagcggtgcccgctat
gcggtcactgacgctgagtccgcgcgcgagtgtattgctgaaaaccagatcctcaggcgc
atcgcccgccactgcgttgaaccgaccaacggcctttttatcacccttcccgaagatgat
ctcggctttcagcaaacctttatcaccgcctgcacggcggcaggcattcaggccgaggcg
ctcgatcctgcacaggcgcgccgtcttgaaccctcggtaaacccggcgttactgggcgcg
gtaaaagtgcctgacggaaccgttgatcctttccgcctgaccgccgccaatatgctcgac
gcgcgggaacacggcgcacagatcctgaccgggcatcacgtcaccgggcttattcgtgaa
ggtaataccgtacgcggggtgcgcgtgtgtgatacgcagtacaatgaacaccgcgagctg
tatgccaccgtcgtggtcaacgcggcggggatctggggccagcgcatcgcggaatacgcc
gatttatccgtccgcatgttcccggccaaaggctcgctgctgatcctcgaccatcgcatc
aataaccatgtcatcaaccgctgccgtaaaccgtctgacgccgacatcctcgtgccgggg
gacaccatttcgttgatcggcacgacctcaatgcatgtggactacagcgaaatcgattac
aaccgcgttaccgccgaagaggtggatattctgctgcgcgaaggggaaaagctggccccg
gtgatggcgcagacgcgtattctgcgtgcctacgcgggcgtgcgtcccctcgtcgccagc
gacaacgatccgagcgggcgtaacgtcagccgcggcatcgtgctgctcgatcacgccgaa
cgcgacggcatggacgggtttatcaccattaccggcggcaagctgatgacctaccggctg
atggcggagtgggccaccgatgccgtctgccgtaagctcggtaacaccgcgccgtgcgtg
acggcggagcgggccctgcccggctcgcagcaatcgacagaaaaaacgctgcacaaaatc
atttcacttcctgccccgcttcgcggttcggcgatttaccgccacggcgaccgcaccccg
acctggcttggtgaagggcgactcagccgcagtctggtgtgcgaatgcgaagccgtgacc
gcaggcgaggtgcaatatgccgtggaaaacctgacggtgcacaacctgcttgatttgcgc
cgccgcacgcgagtcgggatgggcacctgtcagggggaactgtgcgcctgccgtgccgcc
gggctgctacaacgttttcatgccacctcctcaacccagtcgctcgcccagctcagcgat
tttttaaatgagcgctggaaaggcattcagcccgtcgcctggggcgatgccctgcgcgaa
agtgagtttacccgctgggtctatcagggactttgcggtctggagaaggagcacaaccat
gaaatttga

DBGET integrated database retrieval system